KEGG   Idiomarina loihiensis GSL 199: K734_05195Help
Entry
K734_05195        CDS       T02681                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ili00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K734_05195 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ili01007]
    K734_05195 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ili03016]
    K734_05195 (cysS)
Enzymes [BR:ili01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     K734_05195 (cysS)
Amino acid related enzymes [BR:ili01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   K734_05195 (cysS)
Transfer RNA biogenesis [BR:ili03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    K734_05195 (cysS)
 Prokaryotic type
    K734_05195 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f ANAPC4
Motif
Other DBs
NCBI-ProteinID: AGM35903
LinkDB All DBs
Position
1108456..1109835
Genome map
AA seq 459 aa AA seqDB search
MALTVFNTLTRKKQLFEPIQPGHVGIYVCGVTTYDYCHIGHARTYVAFDIVVRYLRKLGY
SVKYVRNITDLDDKIIKRAAENGEDFHQVTERFIREMHKDFDALNLVRPDIEPRVTSHMD
EIILMIERLIENGNAYEAGNGDVLFDVSTFNDYGKLSRQDLEQLQAGSRVDVDAAKQDPL
DFVLWKSAKPGEPSWSSPWGEGRPGWHIECSAMNKKHLGSTFDIHGGGSDLSFPHHENEI
AQSCCANQSEYVKYWMHSGMVQVDNEKMSKSLGNFFTIRSVLEQYDAETVRYFLLSSHYR
SQLNYTQENLDQAHSALERLYTALRDITPQTASEELRSKYWQSFQQAMDDDLNAPEAMSV
LFEIAREINRNRESAPDTAAQLAHVLLELAEVMGLLQQSPEEFLQGDDDDVAKIEALIAK
RNQAREDKDWAAADEARDELTNMGIVLEDGAEGTRWRRA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaccgtatttaacaccctcactcgcaaaaagcagttatttgagcctattcaa
cccggccatgtgggtatttatgtgtgcggtgttaccacttacgactactgccatattggc
catgccagaacttatgtcgcttttgatattgttgtgcgctatctgcgcaagctggggtac
agcgttaaatacgtccgcaacattactgatctagacgataaaatcattaaacgtgcagca
gaaaacggagaagattttcatcaggtgactgagcgttttattcgggaaatgcacaaagat
tttgacgcgttgaacttagtccgtcccgatattgaaccacgtgtaaccagtcatatggat
gaaattatcctgatgattgaacgccttattgaaaacggtaacgcctatgaagccggtaac
ggcgacgttctgtttgatgtttctacatttaacgattatggcaagctcagtcgtcaggac
ttagagcaattacaagcgggttcacgggttgatgttgatgcggccaagcaagatccgctc
gactttgtactctggaaaagtgctaaacccggagagcccagctggtcttcgccctggggc
gaaggtcgcccgggctggcatattgaatgttcagcaatgaataagaagcacttaggcagc
actttcgatattcatggtggcggctctgacttgtcttttcctcatcatgaaaatgaaata
gctcaaagctgctgcgcaaatcaatctgagtacgtaaagtactggatgcacagcggtatg
gtgcaggtcgacaatgaaaaaatgtcgaagtcactaggtaactttttcacgattcgcagc
gtactggaacaatacgacgcggaaacggttcgttattttctgctgtcgagtcactatcgc
tcgcagctgaactatactcaggaaaacctggatcaggcgcactccgctctggagcgctta
tacaccgcattgcgtgacataacaccgcaaaccgccagcgaagaattgcgtagtaaatac
tggcagagctttcagcaggcaatggacgacgacttaaacgcgccggaagccatgagtgtg
ttatttgaaattgcccgggaaattaaccgcaaccgcgagagtgctccggacacagccgcg
cagttagcgcacgttttgcttgagctggctgaggtaatggggctgctgcaacagtctccg
gaagagtttttacaaggtgacgacgacgatgtcgccaaaattgaagcgttgattgccaag
cgtaatcaggcccgggaagataaagactgggccgcagcagacgaagcccgtgatgaacta
accaacatgggcattgttttagaagacggtgctgaaggcacccgctggcgtcgcgcttaa

DBGET integrated database retrieval system