KEGG   Idiomarina loihiensis GSL 199: K734_11360Help
Entry
K734_11360        CDS       T02681                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili00250  Alanine, aspartate and glutamate metabolism
ili00410  beta-Alanine metabolism
ili00430  Taurine and hypotaurine metabolism
ili00650  Butanoate metabolism
ili01100  Metabolic pathways
ili01110  Biosynthesis of secondary metabolites
ili01120  Microbial metabolism in diverse environments
ili02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ili00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    K734_11360
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    K734_11360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    K734_11360
   00430 Taurine and hypotaurine metabolism
    K734_11360
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    K734_11360
Enzymes [BR:ili01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     K734_11360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HTH_8
Motif
Other DBs
NCBI-ProteinID: AGM37133
LinkDB All DBs
Position
complement(2414309..2415958)
Genome map
AA seq 549 aa AA seqDB search
MSPKTDIAEVNQESLYRIFTIPEAPDSTLGKIEKHLSENLMGFLGEHIVAREKPLQEIER
DFDKSQIPEEPAFVSDHTEFLLDKLVAHSVHTASPRFIGHMTSALPYFLLPLAKLMVGLN
QNLVKIETSKAFTPLERNVIGMMHHLVYQQDAPFYNRWMHSAQHSLGAFCSGGTIANMTA
LWVARNRLLQADGDFAGISADGLAAGLQHYGYSKLTVVVSERGHYSLSKAADVLGIGRRN
LVSVATDSDNRIRIDELRKTCEKIAKEGGKVLALVGVAGTTETGHIDPLDEMATVAEEVD
AHFHVDAAWGGATLLSEQHRPLLAGIERADSVTIDAHKQMYVPMGAGLVLFKNPALVKSI
EYHAEYIIRQGSKDLGSHTMEGSRAGMAMMVFSAMHVIGRRGYELLINNSIDKARYFSKL
ISEQDDFEVITEPELCILTYRFVPIKVKTVLDKATPEQLARLTPHLNALTRYIQKRQRET
GQSFVSRTKLTPAQYHHEPTVVFRVVLANPLTTNEMLQEVLCEQRKIAAKATSLRGALHT
EMRELGMLI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
ttgagccctaaaacagacatagcggaagtaaatcaggaatcgctgtatcgcatatttacg
atacccgaggctcctgattcaacgctgggtaaaatcgaaaagcatctctcagaaaacctg
atgggttttctgggggaacatattgttgcccgcgaaaagccgctgcaggaaattgagcgt
gacttcgataagtcgcagataccagaagaacccgcttttgtttccgaccatactgaattt
ctgttggataagctggtcgctcattcggtgcatacggcgtcgccgcgttttatcggccat
atgacatcagccttgccgtatttcctgctgcctttagctaagcttatggtggggctgaat
cagaatctggttaaaattgagacctctaaagcctttacgccgctggagcgtaacgttatt
ggcatgatgcatcatctggtgtatcagcaggacgcgccgttttataatcgctggatgcac
agcgctcagcactcgctgggagctttttgctcgggcggaaccatagccaacatgacggct
ctgtgggtagcgcgcaaccggttgttacaggcagatggtgatttcgcgggcatttcagcc
gatggactggccgcaggtcttcagcattatggctactcaaagttaactgtagtggtgtcc
gagcgtgggcactattcattaagtaaagctgcggatgtacttggtattggtcgccgaaat
ttagtgtcggtggcaacagacagcgataaccgtattcgtattgatgaattacgaaaaacc
tgcgaaaaaattgcaaaagagggcggtaaggtgcttgcgctggttggtgtcgctggtaca
acagaaaccggccacattgatccgctcgacgaaatggcgactgttgcagaagaagtggat
gctcactttcatgtagacgccgcgtggggtggtgcgacgttattgtctgaacagcatcgt
ccgttactggccggtatcgagagagccgacagtgtcactattgatgcgcataagcaaatg
tatgtccctatgggcgctgggctggtgttatttaagaatccggcattggttaagtccata
gagtaccatgccgagtatattattcgtcagggctcgaaagatttaggttcgcataccatg
gaaggctcacgcgcgggcatggctatgatggtgttttcggccatgcatgttatcggtcgc
cgtggttacgagctgctgattaataacagtattgataaagcacgttatttctctaagctg
atttctgagcaggatgactttgaagtcattactgagcctgaactttgtattctgacctat
cgttttgtaccaatcaaagtaaaaacggtgttggataaagcgacgccagagcagctggcg
cgcttgacgccgcacttaaacgcactgacgcgatatattcagaagcgtcagcgggagacg
ggacagtcatttgtatcccggactaagttaacaccggctcaatatcatcatgaaccaacg
gtggttttccgcgtggtgttggcaaacccattaacaaccaatgagatgctgcaggaagtt
ttatgcgaacagcgtaaaattgcggcaaaagccaccagtttgcgtggcgctctgcatact
gaaatgcgcgaactgggtatgcttatttag

DBGET integrated database retrieval system