KEGG   Idiomarina loihiensis L2TR: IL1287Help
Entry
IL1287            CDS       T00218                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00061  Fatty acid biosynthesis
ilo01100  Metabolic pathways
ilo01212  Fatty acid metabolism
Module
ilo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IL1287 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ilo01004]
    IL1287 (fabA)
Enzymes [BR:ilo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     IL1287 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     IL1287 (fabA)
Lipid biosynthesis proteins [BR:ilo01004]
 Fatty acid synthase
  Component type
   IL1287 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AAV82127
UniProt: Q5QYY0
LinkDB All DBs
Position
complement(1383724..1384236)
Genome map
AA seq 170 aa AA seqDB search
MNQSSFTREELLACSRGEMFGPGNSKLPAPNMLMMDRIIEINEDGGSAGKGFIHAELDIN
PDLWFFDCHFKGDPVMPGCLGLDAMWQLLGFHLAWSGGPGRGRALGVGEVKFTGQILPEH
KKVSYFIDMTRVIKRKLFMGVGNGRVEVDGREIYTAKDLKVGLFTDTSTF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatcgagctttactcgtgaagaacttcttgcctgcagtcgcggggaaatgttt
ggtcctggtaacagtaagttgcccgcacctaatatgttaatgatggatcgcatcattgaa
attaacgaagacggtggatcggccggaaaaggttttatccatgccgagctcgatattaac
cctgacctttggttctttgactgtcactttaaaggtgacccggtaatgcctggctgtttg
ggtcttgatgctatgtggcagttgcttggttttcacctggcgtggtctggtggcccgggg
cgcgggcgtgcactaggtgttggtgaagttaaattcaccgggcaaattctgccggaacac
aaaaaagtcagttactttattgatatgacacgagttattaagcgcaaattatttatgggc
gtaggaaatggtcgtgtcgaagttgatggtcgcgaaatttacacagccaaagacttaaaa
gttggcttgtttaccgacacctctactttttag

DBGET integrated database retrieval system