KEGG   Idiomarina loihiensis L2TR: IL1504Help
Entry
IL1504            CDS       T00218                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase/fumarate reductase Fe-S protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00020  Citrate cycle (TCA cycle)
ilo00190  Oxidative phosphorylation
ilo00650  Butanoate metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
Module
ilo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ilo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ilo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IL1504 (sdhB)
   00650 Butanoate metabolism
    IL1504 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IL1504 (sdhB)
Enzymes [BR:ilo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IL1504 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     IL1504 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AAV82342
UniProt: Q5QU31
LinkDB All DBs
Position
complement(1613853..1614566)
Genome map
AA seq 237 aa AA seqDB search
MKKYTFSVYRYNPDVDNAPHMKEYTLEVEDNQDLMVLEALIKLKEQDPSLAFRRSCREGV
CGSDGMNINGKNGLACITHLSSLKSDKIVIRPLPGLPVIRDLIVDMSQFYQQYEKIKPYL
INDDKTPPARERLQSPEDRAKLDGLYECILCACCSSSCPSFWWNPDKFVGPAGLLHAYRF
LIDSRDTATDERLDELDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGHIKSMLLSRAV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacacattttcagtttatcgttataatcctgatgtcgacaacgcgcctcat
atgaaagagtacacgttggaagtagaagataatcaggatttgatggtgctagaagcactg
atcaaattgaaagaacaagatccatcgctggcattccgccgctcgtgccgtgaaggtgtt
tgtggctccgatggtatgaatattaatggtaaaaatggtttggcttgtatcactcatttg
tcttctttgaaatcagacaaaattgtgattcgtccgctaccaggcttgcctgtcattcgt
gatttgattgttgatatgagccagttctatcaacagtacgagaaaatcaaaccgtacctt
atcaacgatgacaaaacgccaccagcgcgtgaacgactgcagtcgccggaagaccgtgct
aagcttgatggtctttacgaatgtattttatgtgcatgttgttcatcttcgtgcccgtcg
ttctggtggaacccagataaatttgttgggccagctggtctgctgcacgcttatcgtttc
ttaattgatagtcgtgacacagcaacggacgagcgtctggacgaacttgatgatgccttt
agtgtattccgttgtcacggaatcatgaactgcgttaacgtatgtccaaaagggttgaat
ccaacaaaggctattggacacatcaaatcgatgcttttgagtcgcgctgtttaa

DBGET integrated database retrieval system