KEGG   Idiomarina loihiensis L2TR: IL1505Help
Entry
IL1505            CDS       T00218                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00020  Citrate cycle (TCA cycle)
ilo00190  Oxidative phosphorylation
ilo00650  Butanoate metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo01130  Biosynthesis of antibiotics
ilo01200  Carbon metabolism
Module
ilo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ilo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ilo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ilo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IL1505 (sdhA)
   00650 Butanoate metabolism
    IL1505 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IL1505 (sdhA)
Enzymes [BR:ilo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IL1505 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     IL1505 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like Thi4 DAO FAD_oxidored FAD_binding_3 DUF3144
Motif
Other DBs
NCBI-ProteinID: AAV82343
UniProt: Q5QU30
LinkDB All DBs
Position
complement(1614579..1616345)
Genome map
AA seq 588 aa AA seqDB search
MTVKTLEYDAVVIGAGGAGMRAALQISQEGLSCALMSKVFPTRSHTVSAQGGITVALGNA
HEDNWEWHMFDTVKGSDYIGDQDAIEYMCKAGPEAILEMENLGLPFSRFENGKVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHLLYQQNVKKKTTVFSEWYALDIVKNQDGEVCGV
TTMDIESGEVYFVKAKAVVLATGGAGRIYSSTTNAHINTGDGIGMALRAGVPVQDMEMWQ
FHPTGIAGAGSLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVSRAMMTEIREG
RGCEGPWGTHLKLKLDHLGKETLESRLPGVCDLSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTDVNGQVLTVGDDGQTSHVKGLFACGEIACVSVHGANRLGGNSLLDLVVFGRSTGMHLG
ETLAANVEAREASSDDIDAALARYNRWENTQKGEDPAQIKKDLQQCMQLNFSVFREGDSM
KEGLAELREIRERLKNARLDDTSKEFNTQRVECLELDNLMETAYSTAVAASFRTESRGAH
SRADYPDRDDEKWLVHTVYRPEKEDMVTREVNMAPKLREAFPPKARTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactgttaaaactttagaatatgatgcagtggtgattggtgctggcggtgccggcatg
cgagcagcactgcaaatttcccaagagggattgagctgcgcgttgatgtccaaagtgttt
ccaacacgctctcacacagtttctgctcagggtggtattaccgtagcattaggtaatgcg
catgaagataactgggaatggcacatgttcgataccgttaaaggttcggactatattggt
gaccaggacgctatcgaatacatgtgtaaagctggccctgaagctattttagaaatggaa
aacttaggtttaccattctcgcgttttgaaaacggcaaagtttatcaacgtccatttggt
ggtcagtcgaagaactttggtggcgagcaggctgctcgtactgccgctgcagctgaccgt
accggtcacgctttgctgcatttgctttatcagcaaaacgtgaagaaaaaaaccaccgta
ttttcagaatggtacgcgctggatatcgttaagaaccaagacggcgaagtttgtggtgta
accaccatggatatcgaaagcggcgaagtttactttgttaaagctaaagccgttgttctt
gctaccggcggtgctggtcgtatttattcttcaacgaccaatgctcatatcaacactggc
gacggtattggtatggctctacgtgctggcgttcctgtacaagatatggaaatgtggcag
ttccatccaaccggtattgccggagcgggctcactcgttacagaaggttgtcgtggagaa
ggcggttacctgctgaacaaagacggcgaacgctttatggagcgttatgcgccaaacgcg
aaagatttggcgtcacgcgacgttgtctcccgcgctatgatgactgaaatccgtgaagga
cgtggttgtgaaggcccatggggtactcaccttaaactgaaactggatcacctgggtaaa
gaaaccctggaaagtcgtttgccgggtgtttgtgacttatcacgtacattcgcacacgtt
gatccggtaaaagaaccaattccggttattcctacctgtcactacatgatgggcggtatt
ccaacggatgttaatggacaagtcctgactgttggtgacgatggtcagacatctcacgtt
aaagggctgtttgcttgtggtgaaattgcttgtgtatctgtacacggtgctaaccgctta
ggtggtaactcactgcttgatttggtggtattcggtcgttcaaccggtatgcatctgggt
gaaacgcttgcggctaacgtagaagccagagaagcaagcagcgacgacattgacgctgca
ctagcgcgttataatcgttgggaaaatactcagaaaggcgaagatccggcacaaattaag
aaagacctgcaacagtgcatgcaacttaatttctcggttttccgcgaaggcgattcaatg
aaagaagggcttgctgagctgcgcgaaattcgcgaacgcctgaaaaacgcccgtcttgat
gacacctccaaagagtttaatactcagcgcgtcgagtgccttgagctagataacttgatg
gaaacggcttactcaactgcagttgctgccagcttccgtacagaaagccgcggtgctcac
agccgtgcagactacccggatcgtgatgatgagaagtggttagtacacactgtttatcgt
cctgaaaaggaagatatggtgacgcgggaagtcaatatggcgcctaaactgcgtgaagct
ttccctccgaaagctcgtacctactaa

DBGET integrated database retrieval system