KEGG   Idiomarina loihiensis L2TR: IL2256Help
Entry
IL2256            CDS       T00218                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00250  Alanine, aspartate and glutamate metabolism
ilo00410  beta-Alanine metabolism
ilo00430  Taurine and hypotaurine metabolism
ilo00650  Butanoate metabolism
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01120  Microbial metabolism in diverse environments
ilo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    IL2256 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IL2256 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IL2256 (gadB)
   00430 Taurine and hypotaurine metabolism
    IL2256 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    IL2256 (gadB)
Enzymes [BR:ilo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     IL2256 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HTH_8
Motif
Other DBs
NCBI-ProteinID: AAV83088
UniProt: Q5QVR3
LinkDB All DBs
Position
complement(2414194..2415843)
Genome map
AA seq 549 aa AA seqDB search
MSPKTDIAEVNQESLYRIFTIPEAPDSTLGKIEKHLSENLMGFLGEHIVAREKPLQEIER
DFDKSQIPEEPAFVSDHTEFLLDKLVAHSVHTASPRFIGHMTSALPYFLLPLAKLMVGLN
QNLVKIETSKAFTPLERNVIGMMHHLVYQQDAPFYNRWMHSAQHSLGAFCSGGTIANMTA
LWVARNRLLQADGDFAGISADGLAAGLQHYGYSKLTVVVSERGHYSLSKAADVLGIGRRN
LVSVATDSDNRIRIDELRKTCEKIAKEGGKVLALVGVAGTTETGHIDPLDEMATVAEEVD
AHFHVDAAWGGATLLSEQHRPLLAGIERADSVTIDAHKQMYVPMGAGLVLFKNPALVKSI
EYHAEYIIRQGSKDLGSHTMEGSRAGMAMMVFSAMHVIGRRGYELLINNSIDKARYFSKL
ISEQDDFEVITEPELCILTYRFVPIKVKTVLDKATPEQLARLTPHLNALTRYIQKRQRET
GQSFVSRTKLTPAQYHHEPTVVFRVVLANPLTTNEMLQEVLCEQRKIAAKATSLRGALHT
EMRELGMLI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
ttgagccctaaaacagacatagcggaagtaaatcaggaatcgctgtatcgcatatttacg
atacccgaggctcctgattcaacgctgggtaaaatcgaaaagcatctctcagaaaacctg
atgggttttctgggggaacatattgttgcccgcgaaaagccgctgcaggaaattgagcgt
gacttcgataagtcgcagataccagaagaacccgcttttgtttccgaccatactgaattt
ctgttggataagctggtcgctcattcggtgcatacggcgtcgccgcgttttatcggccat
atgacatcagccttgccgtatttcctgctgcctttagctaagcttatggtggggctgaat
cagaatctggttaaaattgagacctctaaagcctttacgccgctggagcgtaacgttatt
ggcatgatgcatcatctggtgtatcagcaggacgcgccgttttataatcgctggatgcac
agcgctcagcactcgctgggagctttttgctcgggcggaaccatagccaacatgacggct
ctgtgggtagcgcgcaaccggttgttacaggcagatggtgatttcgcgggcatttcagcc
gatggactggccgcaggtcttcagcattatggctactcaaagttaactgtagtggtgtcc
gagcgtgggcactattcattaagtaaagctgcggatgtacttggtattggtcgccgaaat
ttagtgtcggtggcaacagacagcgataaccgtattcgtattgatgaattacgaaaaacc
tgcgaaaaaattgcaaaagagggcggtaaggtgcttgcgctggttggtgtcgctggtaca
acagaaaccggccacattgatccgctcgacgaaatggcgactgttgcagaagaagtggat
gctcactttcatgtagacgccgcgtggggtggtgcgacgttattgtctgaacagcatcgt
ccgttactggccggtatcgagagagccgacagtgtcactattgatgcgcataagcaaatg
tatgtccctatgggcgctgggctggtgttatttaagaatccggcattggttaagtccata
gagtaccatgccgagtatattattcgtcagggctcgaaagatttaggttcgcataccatg
gaaggctcacgcgcgggcatggctatgatggtgttttcggccatgcatgttatcggtcgc
cgtggttacgagctgctgattaataacagtattgataaagcacgttatttctctaagctg
atttctgagcaggatgactttgaagtcattactgagcctgaactttgtattctgacctat
cgttttgtaccaatcaaagtaaaaacggtgttggataaagcgacgccagagcagctggcg
cgcttgacgccgcacttaaacgcactgacgcgatatattcagaagcgtcagcgggagacg
ggacagtcatttgtatcccggactaagttaacaccggctcaatatcatcatgaaccaacg
gtggttttccgcgtggtgttggcaaacccattaacaaccaatgagatgctgcaggaagtt
ttatgcgaacagcgtaaaattgcggcaaaagccaccagtttgcgtggcgctctgcatact
gaaatgcgcgaactgggtatgcttatttag

DBGET integrated database retrieval system