KEGG   Ipomoea nil (Japanese morning glory): 109148091Help
Entry
109148091         CDS       T04663                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00071  Fatty acid degradation
ini00592  alpha-Linolenic acid metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01212  Fatty acid metabolism
Module
ini_M00087  beta-Oxidation
ini_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109148091
   00592 alpha-Linolenic acid metabolism
    109148091
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     109148091
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     109148091
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     109148091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 109148091
NCBI-ProteinID: XP_019151408
LinkDB All DBs
Position
Un
AA seq 724 aa AA seqDB search
MAVPTVTMEVGNDAVAVITISNPPVNALAVPIIQGLKEKFTEAARRNDVKAIVLTGSGGR
FSGGFDINVFEQVHKNGDISVLPDVSVELVVNLIEDGKKPAVAAIQGLALGGGLELALGC
HARISAPKAQLGLPELTLGVIPGFGGTQRLPRLVGLQKGVEMMLTSKPILSEEGKKLGLI
DAIVSPAELIKVSRQWALDIAERHKPWMRSLHRTDKLCSLSEARDILKVARQQAKQTAPN
MPQHLVCLDVIEEGIVHGGYSGVLKEARDFKQLVLSDTSRGLVHIFFAQRATSKVPNVTD
VGLKPRPIKKVAVIGGGLMGSGIATALILSNTYVLLKEISAEYLHKGIKSIEENIRILVS
RKKLAQDKAEKALSLLKGVLDYAEFKDVDMVIEAVIENVPLKQKIFSDIEKACPPHCILA
SNTSTIDLNIIGEKTRSQDRIIGAHFFSPAHVMPLLEIVRTEKTSAQTIIDLIAVGKAIK
KVPVVVGNCTGFAVNRTFFPYSQGAHFLVHLGVDAFRIDAQITKFGLPMGPFQLQDLAGY
GVAVAVGKEFGAAFSDRVFKSPLVDLLIKSGRNGKNNGKGYYIYQKGTKPKPDPSVLPII
EESRRLINIMPGGKPISVTDQEIVEMVLFPVVNEACRVLDEGIVVRASDLDVASVLGMSF
PSYRGGIVFWADTVGAAHIYKSLKKWSELYGNFYKPSSFLEERALKGIPLSAPVSASSAS
RSRM
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccgacggtgactatggaggtcgggaacgacgccgttgctgtgatcaccatc
tccaatcctcccgtcaacgcgttagccgttccgataattcaaggcttgaaggagaagttc
acggaggctgccaggagaaacgatgttaaagctattgttttgactgggagtggggggaga
ttctctggtggttttgacatcaatgtttttgaacaagttcacaagaatggggatatttct
gtactaccagatgtttctgttgaacttgtagtcaacctgattgaagatggcaaaaagcct
gctgttgctgcgatacaaggactcgcacttggaggtggcttagaattggcattgggatgc
catgctcgcatttctgcaccaaaagcccaacttggattgccagaacttaccctcggggtt
atacctggctttggaggtacacaacgtcttccaaggcttgtgggattgcagaaaggtgtt
gaaatgatgctgacatctaaacccatattgtctgaagaagggaagaaattaggtcttatt
gatgcaattgtgtccccagcagaattgattaaagtgtcacggcagtgggcactggatatt
gcagaaaggcacaaaccttggatgcgatcccttcataggactgacaaactatgttccctt
tcagaagcacgggatattctgaaggttgctagacaacaagcaaagcagacagctcccaat
atgcctcaacatctggtttgccttgatgtgattgaagaaggcattgttcatggaggatac
agtggagttctaaaggaagctagagatttcaaacagcttgtattgtcagatacttcaaga
ggtcttgttcacatattttttgcacaaagggcaacatcaaaggtgcccaatgtcacggat
gttggtctcaaaccaaggccaataaagaaggttgctgtaattggtggaggtctaatgggt
tctggcatagctacagctctcattctgagcaacacatatgttctcctcaaggaaattagc
gctgaatatcttcataaagggataaaatccatagaagaaaatattcgtatcctggtatca
aggaaaaagttggctcaggataaagcagaaaaagcactctcattgcttaaaggtgtattg
gattacgcagaatttaaggatgtggacatggttatagaggctgtgattgaaaatgttcct
ctaaaacaaaaaattttcagcgatattgagaaggcatgtcctcctcattgtatactggca
tctaacacatctactatagaccttaacattattggtgagaagaccagatctcaagatagg
atcataggcgctcattttttcagccctgctcatgtgatgccactgctggagattgtacgg
acagagaagacttcagctcaaacaatcattgaccttattgctgttgggaaagcaataaag
aaagtacctgttgtggtggggaattgtaccggctttgctgtaaacaggaccttcttccca
tattcccagggagcacattttctggtccaccttggagttgatgctttcaggattgatgcc
caaattacaaaatttggcctccctatgggtccattccagctccaagatttagcaggatat
ggggtagctgttgctgtaggaaaagaatttggtgctgctttttctgaccgtgtattcaaa
tctcccttggttgatctcctcattaaaagtggtcgaaatggaaaaaataatggaaaagga
tactacatttatcagaagggaactaaaccaaaacctgatccttctgtgcttccaatcata
gaggagtctagaaggctgataaatattatgcctggtgggaagccaatatctgtgactgac
caagaaattgttgagatggttctctttccagtggtgaatgaggcttgccgtgttcttgat
gaagggatagtcgtccgagcatcagatcttgatgttgcatctgttcttggaatgagcttc
ccttcttacagaggggggattgtgttctgggcggatactgtgggggctgcccacatatat
aaaagccttaagaagtggtcagaattatatggcaacttttacaagccctcgagtttcttg
gaagaaagagcactcaaaggcattccattgagtgctcctgtatcagcctcttcagcgtca
agatcgcgaatgtaa

DBGET integrated database retrieval system