KEGG   Ipomoea nil (Japanese morning glory): 109150577Help
Entry
109150577         CDS       T04663                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00620  Pyruvate metabolism
ini00710  Carbon fixation in photosynthetic organisms
ini01100  Metabolic pathways
ini01200  Carbon metabolism
Module
ini_M00168  CAM (Crassulacean acid metabolism), dark
ini_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ini_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ini_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109150577
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109150577
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109150577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109150577
NCBI-ProteinID: XP_019154064
LinkDB All DBs
Position
Un
AA seq 964 aa AA seqDB search
MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK
LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP
PNEPYRVILGDVRDKLYQTRERTRQLLAHGHSDIPEEATFTNVEQFLEPLELCYQSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAVTTHLEIGSYREWSEERR
QEWLLSELSGKRPLFGPDLPKTEEIADVLDTLHVIAELPPDCFGAYIISMATAPSDVLAV
ELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSIEWYRNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELVKVAKKYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTVHG
NLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEISVVATE
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYITTLNVCQA
YTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgaaatctggagaagatggcctcaattgatgcccaattgaggcttttggtg
cccgggaaggtctcagaggatgacaagcttgttgagtatgatgctttgcttctggatcgg
tttcttgatattcttcaggacttgcatggagagaatctcagggaaacggtccaagagtgt
tatgagctctcagccgagtatgaaggtaggcacgaccccaagaagctggaggagcttgga
aatgtgttgacaagtctagatccgggggattccatcgtgattgcaaaatctttctctcac
atgcttaacttggctaacttggccgaggaggttcagattgcctatcgtcggagacagaaa
ctgaagaagggggattttgttgacgagaatagtgcaataactgaatccgacattgaagag
accctcaaaaggcttgtggtggacatgaagaagtctcctcaggaagtatttgatgcattg
aagaaccagacggtggatcttgttttaactgctcatcctacgcaatctgtccggagatca
ttgcttcaaaagcatgcaaggatccgggattgtttggctcagctgtataacaaagacatt
acacctgatgataaacaggagctcgatgaggctttgcagagggagattcaagctgctttc
cgcactgatgagattcgaaggactcctccgaccccccaggatgaaatgagagcggggatg
agctacttccatgagacgatttggaagggcgttccaaggtttttgcgacgtgttgacaca
gctcttaaaaacataggaattaatgaacgtgttccttacaatgccccgttgattcaattc
tcctcttggatgggtggcgatcgtgatggaaatccacgggtgactcccgaggtcacaagg
gatgtttgcttactagccaaaatgatggcaacaaacttgtactattcccaaatcgaggat
cttatgtttgagatgtctatgtggcggtgcaatgacgagcttcgtgctcgagcagatgaa
cttcaccggtcatcgaggagagatgcaaaacactatatagagttttggaaacaagttcca
ccaaatgaaccgtaccgtgttattcttggtgatgtgagggataaactataccagactcgt
gagcgtactcgccagttgttagcccacggacactctgatatccccgaggaggcaactttc
actaatgtcgagcagttcttggagcctctagagctgtgctaccaatctctgtgtgcttgt
ggagatcgacccattgcagatggaagtctgctggattttctgaggcaagtttcgaccttt
gggctctcgctggtgaggcttgacattaggcaagaatcggatcgccacacggatgtcttg
gatgctgtgactacgcatttggagattggttcgtatcgagaatggtctgaagagcgtagg
caggagtggcttctgtctgaactgagtgggaaacggcctctatttggacccgatctcccg
aaaaccgaagagattgctgatgtcttggacacgttacatgtcatagcagagctcccgccc
gactgctttggggcgtacattatctctatggccactgctccatctgatgtgctagcggtt
gagcttctacagcgcgaatgccgggtgaagcagcccctaagggtggtcccgcttttcgag
aagctagcggatctcgaggctgctcctgctgctgttgcccgccttttctcgattgagtgg
tacagaaaccggatcaatggcaagcaagaagtcatgattgggtactcagactcgggcaaa
gatgctggccgcctatctgctgcctggcagctatacaaggctcaagaggagctagtgaaa
gtcgcgaaaaagtatggtgtgaagctcactatgttccacggcagaggtggcacagttgga
cgaggaggcggcccgactcatctcgctatattgtcccaaccacccgacacagttcatggg
aatctccgtgttactgttcagggcgaagttattgaacaatcgttcggggaggaacacctg
tgctttaggacactccaacgtttcaccgctgctactctggagcacggtatgcatccaccg
gtctctccaaaacctgaatggcgtgcacttatggatgaaatcagtgtcgttgccaccgaa
gagtaccgctcaatagtcttccaagaaccacgctttgtggagtatttccgccttgccacg
cctgagctagagtatggcaggatgaacattgggagtcggccatcaaagcgtaaaccaagt
ggaggcattgaatcccttagagccattccatggatttttgcgtggacgcaaaccaggttc
cacctccccgtttggctaggtgttggtgcagcgttcaaatgtgctatccaaaaggacatc
aagaacctcaaaatgtttcaggaaatgtacaacgaatggccattctttcgggtcaccatt
gatttggtagaaatggtgttcgccaagggagatccagggatagctgcactgtacgacaag
cttctcgtctcaaaggatttatggtcatttggcgagcgcttgaggtccaactacgaggac
acaaagagccttctcctacagattgctggacataaggatcttctcgagggagatccctac
ttgaaacagcaactcaagcttcgcgattcctacataacaaccttaaatgtctgtcaagct
tacaccctgaaacgcattcgtgacccagactaccatgtcaccctgaggccccacatcagc
aaagactatgtcgattccaagcatgctgatgagctcgtgaagctgaacccaacgagcgat
tatgcccccgggttggaggacaccctcatcttgaccatgaagggtattgctgctggaatg
cagaatacaggttaa

DBGET integrated database retrieval system