KEGG   Ipomoea nil (Japanese morning glory): 109151275Help
Entry
109151275         CDS       T04663                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00020  Citrate cycle (TCA cycle)
ini00190  Oxidative phosphorylation
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109151275
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109151275
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109151275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 109151275
NCBI-ProteinID: XP_019154742
LinkDB All DBs
Position
Un
AA seq 630 aa AA seqDB search
MWRCVSRGLRIPSDRSIAGRSHFRRLFSSQTQNVGGSSYTVVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAASTILA
TGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGVPTNYHGEVVTIKGNDPDAVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGQQQKPLEKDSGEKTIA
WLDKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLQEGCQLIDKTWDSFHDVKVKDR
NLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWE
NEKVRLEYRPVHMNTLDDEIETFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtgtcgcgtggcctgcgcattccatccgacagatcaatcgccggccgt
tctcatttccggcgactcttctcatctcaaactcagaatgtgggcgggtcttcgtataca
gtggttgatcacacatatgatgctgtggtggtaggtgcaggaggtgcagggcttagggcg
gcaatagggttgtctgagcatggattcaatacagcatgcatcaccaagctatttcctact
cgttctcacactgttgcagctcagggtggtataaatgctgcattaggaaacatgactgag
gatgattggaggtggcacatgtatgatacagttaaaggaagcgattggctaggtgatcag
gatgctattcaatacatgtgtagggaagcaccaaaagcagttatagaacttgagaattat
gggctgccattctcccgaacagaagatgggaaaatataccaacgtgcatttggtggtcag
agtcttaattttggaaaaggtggacaagcatatcgttgtgcatgtgctgctgatcggact
ggtcatgctttgttgcatactttgtatggccaggctatgaaacataatacacagttcttt
gtggaatattttgcgttggatttactaatgaatagtgatggaagttgccaaggtgtaatt
gcactaaacatggaggatgggacattacatcgcttccgtgctgcttctactattttggcc
actgggggttacggtagaacatatttctctgcaacctctgctcatacgtgcacaggagat
gggaatgctatggttgcacgtgctgggcttcctctccaggatcttgagtttgtgcaattt
catccaactggtatatatggagctggttgtctcatcactgaaggatctcgtggtgaaggt
ggcattctcaggaatagtgaaggtgagcgatttatggaacgatatgcaccaacagcaaag
gatcttgcctcaagggatgtcgtttcaaggtctatgacaatggaaatccgagaagggcgt
ggtgtagggccactaaaggaccacatctacctccacttgaaccacttacccccagaggta
ctcaaagaaagacttcctggtatttctgaaactgctgctatttttgctggtgttgatgtt
acaaaggagccaattcctgttttgcccactgtgcattacaatatgggtggcgttccaaca
aattaccatggagaggtggtgactattaaaggtaatgatcctgatgctgttgtgcctggc
ctcatggctgctggagaagcagcctgtgcatcagttcacggtgccaatcggttaggcgca
aattctcttcttgacattgttgtttttggccgggcatgtgctaatcgggtcgcagaaatc
catagaccagggcaacaacaaaagcctttggaaaaggattctggagagaagactattgca
tggttggacaagcttagaaattcaaatggttcattgcccacatctaagattcggttgaat
atgcaaagagtaatgcaaaacaatgctgctgttttccgtacacaagagactttacaagaa
ggttgtcagttgattgacaagacatgggacagtttccatgatgtgaaggtgaaggatcga
aatttgatctggaactcagaccttatagaaactattgagttggaaaacctgttgattaat
gcatgtattacaatgcactctgctgaagccagaaaagaaagcagaggtgcacatgcccgt
gaagattttacgacaagagatgatgagaaatggatgaaacatacattgggatattgggag
aatgagaaagtaaggctagaatacaggcctgttcacatgaatacattggatgatgaaatt
gagacattcccaccgaaggcgcgtgtgtattag

DBGET integrated database retrieval system