KEGG   Ipomoea nil (Japanese morning glory): 109151323Help
Entry
109151323         CDS       T04663                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03030  DNA replication
ini03410  Base excision repair
ini03420  Nucleotide excision repair
ini03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109151323
   03410 Base excision repair
    109151323
   03420 Nucleotide excision repair
    109151323
   03430 Mismatch repair
    109151323
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ini03032]
    109151323
   03400 DNA repair and recombination proteins [BR:ini03400]
    109151323
Enzymes [BR:ini01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109151323
    6.5.1.6  DNA ligase (ATP or NAD+)
     109151323
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109151323
DNA replication proteins [BR:ini03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109151323
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109151323
DNA repair and recombination proteins [BR:ini03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109151323
   NER (nucleotide excision repair)
    Other NER factors
     109151323
   MMR (mismatch excision repair)
    Other MMR factors
     109151323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 109151323
NCBI-ProteinID: XP_019154828
LinkDB All DBs
Position
Un
AA seq 1414 aa AA seqDB search
MSTAPETLTLDSTSIYTAALNSISSQIPPPSLPLPSLPSTIPQPKLIPKTRFIIDGFKHA
GDFSISYFLSHFHSDHYTGLSPNWTRGVIYCSSITARLLVEVLQVPAPFVVSLPLSKQVL
IDGCEVFLVDANHCPGAVQFLFKIPVHSCNGKFERYVHTGDFRYCNSMKLDHILNAFVGA
DAVFLDTTYCNPKYVFPSQDEAIDYIVGVIESSGVENEGSLKSVLFLVATYVIGKEKILM
EIARRCQRKIHVENRKMLVLRVLGHEDGVFTEDESETDIHVVGWNVLGETWPFFRPNFVR
IQEIMTEKGYSKVVGFVPTGWSYEVKRNKFPVRKKDSFEIHLVPYSEHSNYDELREYVKF
LKPKCVIPTVGIDVEKLDSKHANAMRKHFAGLVDEMAIKQDFLMGFHRVIQGVDENIVKK
PACDIGISQIQNEPVLSDLRGSKDGNLENIEESSPQNESKLQGLEDIDEDAMEESIKELQ
DFLPSWVIRSQMMDLLRISERNLVDAVSHFYEHETEFHEQVVTSESCASISQEIRKNEFS
LPFKLTQSESSFSEPWPLKSLKRNDIVSLSKSPSQNYKSSSRKKSVTIGISPSKKKRNTE
TKSSKRAKLNSKMDSSGSKQCTITKFFSKTVPPDSKSENDGAAIEYCHSDKNAALSATIT
EPYKDEIDEFIRIVNGNESLQSHAASIIQKTKGDINRALDIYYNHANEATEVKQDIQDDS
SKGVKSQCVQKVLSSQDSKPSKKWGAEVHMVLNGPSMENVAEKNVSLPPEKYSPLEHACW
RSGQHAPYLHLARTFELVEEEKGKVKATSMLCNMFRSLLALSPEDVLPAMYLCTNKIAPD
HENIELNIGGSIVIAALEEACGAKKAKIQDLYKNLGDLGDVAQVCRQTQSLLAPPATLTI
QSVFSTLKQISVQTGSGSTIRKKSLVLSLLRSCREKEMKFIVRTLVRNLRIGAMMRTILP
AFAQAIAIHSSSSKDLVGNMKEHLQRLSTEVVEAYNILPSLDLLVPSLMEKGTEFSSMIL
SMVPGIPIKPMLAKITNGASQVLNGFQNKAFTCEYKYDGQRAQIHRLADGSVRIFSRNGD
ETTRRFPDVVDIIKESCNLTGQTFILDAEVVAINRKNDSKLMSFQELSSRERGSKDSLIT
LDKIKVDICIFVFDIMFANGAQLLNLPLRQRRKYLKDLFGEGKGGYLEYAREMTVEVDDS
STDNEATLTRINCFVNDALQSSCEGIMVKSLDVDAGYTPSKRSDAWLKVKKDYMEGLSDS
LDLVPIGAWYGNGRKAGWYSPFLMACYNPDTEEYQSVCRVMSGFSDAFYKEMKDFFSGDK
ILGQKPPYYQTAEVPDVWFSPELVWEIRGAEFTVSPVHHAAMGLVHPSRGISVRFPRFIH
SVADRNPEECSIAADIAEMFSSQTRKMDVSNEPK
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcacccgaaaccctaaccctagactccacatccatctacactgccgctctc
aactccatttcctcccaaattccaccgccctctcttcccctccctagtctaccttcaact
atcccccaacccaaacttattcccaaaactcgcttcattatcgatggcttcaaacacgcc
ggcgacttctcaatctcctacttcctctctcatttccactccgaccactatactggcctt
tctcccaattggaccagaggtgttatatattgctcgtcaatcactgctcgcctccttgtc
gaagtccttcaagtcccggcaccctttgtggtgtctttacccctatcaaagcaggtatta
atagacggctgtgaggtatttctggttgatgctaatcattgccctggcgcagttcagttc
ctatttaaaattccggttcatagttgtaatggtaagtttgagcgatatgttcatactggc
gattttcggtactgcaattcgatgaagttagatcatatactaaatgcatttgttggtgct
gatgctgtctttctggatactacttattgtaatccgaagtatgtgtttcccagtcaagat
gaggctattgattacattgttggtgttatagagtcgagtggagttgagaatgagggctca
ttgaagagtgtcctgtttcttgttgctacttatgttatcgggaaagagaagattttgatg
gaaattgcacggagatgtcagaggaagatccatgtggaaaatagaaaaatgttagttctg
agagtcttggggcatgaggatggagtttttactgaagatgaatctgaaactgatattcat
gtagttggatggaatgtcttgggtgagacctggcccttttttaggcctaattttgtgaga
atacaagagattatgactgagaaagggtattctaaagttgtgggctttgttcctactggt
tggagttatgaggtaaagcggaataagtttccagtgaggaagaaagattcctttgaaatt
catcttgtgccatatagcgagcattcaaactatgatgagcttagggaatatgtgaaattt
ttgaaacctaagtgtgttattcctacagttggtatagatgttgagaagcttgatagcaag
catgctaatgccatgcgtaagcattttgctggcttggttgatgaaatggctattaagcaa
gattttctaatgggatttcatcgtgtgatccaaggagtggatgaaaatattgtcaaaaaa
cctgcttgtgacatagggatatcacagatacagaatgagcccgttttatcagatctcaga
ggcagtaaagatggtaatttggagaatattgaggagtcatctcctcaaaatgaatccaag
ttacaaggcttagaagacattgatgaagatgccatggaggaatctataaaagaacttcaa
gacttcttgccctcttgggtcattcgatcacagatgatggatttacttaggatttcagaa
agaaatcttgttgatgctgtttctcatttttatgagcatgaaactgagtttcatgaacaa
gtagtaaccagcgaatcttgtgcatctatatcccaggaaatccgtaagaatgagttttca
ttgccttttaaattaactcagagtgaatcctctttttcagagccatggcctcttaagagc
ctcaaaagaaatgacattgtttctttaagtaaaagtcctagtcagaactataaatcttct
agtaggaagaagtcagttactattggtatttctccgagtaaaaagaagagaaatactgaa
actaaatcttctaaaagagcaaaactgaattctaagatggattctagtggatcaaagcaa
tgtactataacaaagttctttagtaaaacagtgcctcctgactccaaaagtgaaaatgat
ggagctgcaattgagtattgccatagtgataaaaatgcagcactgagtgccaccattact
gagccatataaagatgagattgatgaatttattcgaattgttaatggtaatgaatcatta
caaagccatgctgcttctataattcagaagactaaaggtgacatcaatagggcattggat
atatattataaccatgccaatgaagcaacagaagtgaaacaagatatccaggatgatagc
agtaagggggtcaaatctcaatgtgttcaaaaggtgctttcttctcaagattctaagcca
tctaaaaaatggggagctgaggttcatatggttctgaatggaccatcaatggagaacgtt
gctgaaaaaaatgtatcgcttccaccagaaaaatattcacctctggaacatgcttgctgg
aggagtggacagcatgctccatacctacatcttgcacgaacttttgaactggttgaggaa
gaaaagggaaaggtaaaagctacgtcaatgttgtgcaacatgtttaggagcttgctagct
ttgtctccagaggatgtgttacctgccatgtatttgtgcacaaacaagatagctcctgac
catgaaaatattgaattgaatattggtggtagtattgttatagcagcactggaagaggca
tgtggggcaaaaaaagccaaaatacaagatttgtataaaaatcttggtgatcttggtgat
gttgctcaagtttgccggcaaacacaatctttactagctccacctgctacgctaacaatt
caaagtgtattttccacactcaaacagataagtgttcaaacaggtagtgggagtactatc
cggaagaaaagccttgttttgagtctcttgcgttcatgtagagagaaggaaatgaagttt
attgtcagaactttggttagaaatttgcgcattggagccatgatgagaactattctgcct
gcatttgctcaagcaattgcaatccattctagttctagtaaagaccttgttggcaatatg
aaagaacatttacagcgcctttcaacagaagtagttgaagcatataacattcttcccagt
ttggatctgcttgttccttctttaatggaaaaagggactgaattttcttcaatgatcttg
tctatggttccaggcatcccaatcaagccaatgcttgcaaaaattactaatggagcctct
caagtactgaacggttttcaaaacaaagcctttacatgtgaatacaagtatgatggccag
cgagcccagattcacagattagctgatggctctgtgcgcattttctcaaggaatggggat
gaaacaacaagaagattccctgatgtagttgatataattaaagaatcatgcaatcttact
ggacaaactttcatactagatgctgaggtggttgcaataaataggaaaaatgattcaaaa
ctcatgtcattccaagaattatcttcccgagaaagagggagtaaagattccttgatcaca
ttagataaaataaaggttgatatatgcatttttgtctttgatatcatgtttgccaatgga
gcgcagttgttgaatcttccactgcggcaaagacgaaaatatttgaaggatttgtttggt
gagggtaaaggaggatacttggagtatgcaagagaaatgacagtagaagtagatgattct
tctacagataatgaagctacattaacaaggattaactgctttgtcaatgatgcattacaa
tcttcatgtgaaggaattatggttaaatctctggatgtagatgctgggtatacaccatca
aagcgctctgatgcatggctgaaggttaagaaagattatatggaaggattaagtgactcc
ctcgacttggtgcccattggtgcttggtacgggaacggaaggaaagcaggatggtatagt
cctttccttatggcttgttataaccctgacactgaagaatatcagagcgtctgccgtgtc
atgtctgggttctcagatgcgttctataaagagatgaaagacttcttctctggggataag
attttggggcaaaaaccgccatactatcaaactgctgaagtccctgatgtgtggttttct
cccgaactagtttgggagatacggggtgctgagttcacagtatcaccagttcatcatgca
gccatgggtttagttcatccatctcggggtatttctgtcagatttccaaggttcattcac
tccgttgctgatagaaatcccgaggaatgtagcatagctgcagatattgctgaaatgttt
agctctcagactcgaaaaatggatgtcagcaatgaacctaaataa

DBGET integrated database retrieval system