KEGG   Ipomoea nil (Japanese morning glory): 109153634Help
Entry
109153634         CDS       T04663                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00562  Inositol phosphate metabolism
ini01100  Metabolic pathways
ini04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109153634
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109153634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ini01009]
    109153634
Enzymes [BR:ini01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109153634
    3.1.3.48  protein-tyrosine-phosphatase
     109153634
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109153634
Protein phosphatases and associated proteins [BR:ini01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109153634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase CDKN3 DSPn
Motif
Other DBs
NCBI-GeneID: 109153634
NCBI-ProteinID: XP_019157032
LinkDB All DBs
Position
Un
AA seq 415 aa AA seqDB search
MGLRLGKQGQKKAAPASQLSYIHAQQDLVKFLFTSCYIRNLVSKQRRRLLVGGYDLDMTY
ITDRLLAMSFPAEHMRAMYRNPLWQVKSVLDMRHSGHYKVYNLCIEQSYDPTHFHGRVER
YPFDDNHVPPLQMVKEFCEDVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLVYTGMSAE
EALQVYADKRTTNNHGVSIPSQRRYVEYWEKVLSFPDRVDRGLPDVNLPKPCARELRRIR
LYDTVNVDSIFFVVSELQNIPGERYCPPVEVSKSCCRGNKNEFHRPNSPRYYYSFLEGNE
EEDEVEEEKEPRLVIQMDTESSMLYQKTCLDYYYETPLQVTGDVRIIFYEKLIGGRLFYA
CFNTSFIKSGLLQFSLRELDKVGKKGKSICGPAFCVELIFGPANPSILMKKDDDI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggctaaggttgggaaaacaggggcaaaagaaagctgcaccggcatcacaattgagc
tacatccatgcccaacaagacctcgtaaaatttctcttcacgagttgttacattcgaaac
ttggtctcgaagcagagaaggcgattgctcgtcggaggttatgatctggacatgacatac
ataaccgacaggcttctggcgatgtcgtttccggcagaacacatgcgagcaatgtaccgg
aaccctttgtggcaggttaaatccgtgctggatatgagacattcaggacattataaggtc
tataacttgtgtatcgaacaaagttatgacccgacgcattttcatggtcgcgttgagagg
tatccatttgatgataaccatgtcccacctctccaaatggtcaaggaattttgtgaggat
gtccattcttggttgtcaaatgacccaaagaacattgctgtcatacattgcatggctgga
aaaggtcgaactggattaatggtatgtgcatacctagtttacaccggcatgtcagccgag
gaagctctgcaagtctatgcagataagagaactaccaacaaccatggagtttcaatacca
agccagcgtcgttatgttgagtactgggagaaagtactttccttcccagatagggttgat
cgtggccttccagatgtgaatttgcccaaaccatgcgctagagagcttcgtcgcattcga
ttatatgatacagtaaatgttgattctatcttctttgtggtctctgagctgcaaaatatt
cctggagagagatattgcccgcctgtagaagtgtctaagagttgttgcaggggaaataag
aatgagttccataggcccaatagccctcgttattattactcgtttctggaaggcaatgaa
gaagaagatgaagtagaagaagaaaaagaacctcgtttggttatccaaatggacacagaa
agctccatgctctaccagaaaacctgccttgactactattatgaaacccctttgcaagtc
actggagatgtccgtataatattctacgagaagcttatcggagggcgtctcttttatgca
tgcttcaacacatcatttataaagagcggcctgctacaattttctctgagggagctggac
aaagttggaaagaagggaaagtcaatctgcgggccagcattttgcgtggagttgatcttc
gggccggcaaacccaagcatcttgatgaagaaggatgatgatatataa

DBGET integrated database retrieval system