KEGG   Ipomoea nil (Japanese morning glory): 109155272Help
Entry
109155272         CDS       T04663                                 

Definition
(RefSeq) 3-dehydroquinate synthase, chloroplastic-like
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01230  Biosynthesis of amino acids
Module
ini_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109155272
Enzymes [BR:ini01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     109155272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-GeneID: 109155272
NCBI-ProteinID: XP_019158499
LinkDB All DBs
Position
Un
AA seq 211 aa AA seqDB search
MASSCFCPPNPAFSPHSHRKATLCDFVVRLPASATLPSRCRLEYNAPNRLKVFASSAVPA
MDQSPQSKASSPVPTVVEVDLGDRSYPIYIGSGLLHKPEFLQRHIHGKKVLIVTNTTVAP
LYLDKTISALTDGNPNVSVETVILLDGEKFKNMETLMKVFDKAIESRLDRRCTFVALGGG
VIGDMCGYAAASYLRGVNFIQIPTTVMAQVQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcttgtttctgcccacccaatcccgccttctccccacactcccaccgcaaa
gccaccctatgtgacttcgtcgtgcgcctccctgcctccgctactcttccttctcggtgc
cgtttggagtataatgctcccaaccgactaaaggtgtttgcaagctccgcggttcccgcg
atggatcagtctcctcagagtaaagcatcttctcccgtccccacggttgttgaggttgat
ttgggtgaccggagctacccgatttacatcggctctggtcttcttcataaacccgagttt
cttcagaggcatattcatggcaagaaagttcttatagtcacaaatactacagtagctcca
ttatatctggacaaaactatcagtgctttaacagatggaaatcctaatgttagtgttgaa
actgtgatcttgctagatggagagaaatttaagaacatggaaactctcatgaaagttttt
gataaagctattgaatcacgattggaccgacggtgtacatttgttgctctcggtggtgga
gttattggtgatatgtgtggatatgctgctgcttcttatctccggggagttaattttatt
cagattcctacaactgttatggcacaggtacaatga

DBGET integrated database retrieval system