KEGG   Ipomoea nil (Japanese morning glory): 109156797Help
Entry
109156797         CDS       T04663                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00010  Glycolysis / Gluconeogenesis
ini00020  Citrate cycle (TCA cycle)
ini00620  Pyruvate metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01200  Carbon metabolism
Module
ini_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109156797
   00020 Citrate cycle (TCA cycle)
    109156797
   00620 Pyruvate metabolism
    109156797
Enzymes [BR:ini01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     109156797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 109156797
NCBI-ProteinID: XP_019160190
LinkDB All DBs
Position
Un
AA seq 474 aa AA seqDB search
MASLLQSQSPALSFSSSVSSAQPLRRLSSAAFPTRMRRRSLPAIQSKIREIFMPALSSTM
TEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAVIVVNDGETAPVGAPIG
LLAETEDEIAEAKAKALSVGSGSSAPPSTEASTDSPPPKVEAAAPPPPPAAAPEGPRRIV
ATPYAKKIAKQHRIDINKVAGTGPFGRITAEDVEKAAGITPKKSTAAPLQAAAPAAPSPA
KTSPSSYPEIPGSTVVPFTAMQAAVSKNMLDSLSVPTFRVGYPISTDALDALYAKVKSKG
VTMTALLAKAAAMALAQHPVVNATCKDGKCFTYNSSINIAVAVSINGGLITPVLEDADKL
DLYLLSQKWKELVEKARAKKLQPHEYSTGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGA
SKPTVVTDADGFFSVKNRMLVNVTADHRIIYGADLAAFLQTFSKIVENPDSLTM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctccttcaatcccagtctccagctctctcattctcttcctccgtctcctct
gctcagcccctccggcgcctcagttccgcggcgtttcctaccagaatgcggcggcgcagc
ctccctgctattcaatcgaagatccgcgagatcttcatgccggcgcttagctccaccatg
accgagggcaagatcgtttcgtgggtgaagtccgagggcgatgtgctctccaaaggcgag
tcggttgtggtggttgagtcggacaaagcggatatggatgtggagaccttttatgatggc
attttggcagttattgttgttaacgacggcgagacagctccggtcggggctccgatcggg
cttttagccgagactgaggacgaaatcgctgaggccaaagctaaagccctatccgttggt
tctggctcatcagctccgcctagtactgaggcttccactgattctccccctcccaaagtt
gaagctgcagctccacctccgccgcctgcggcggctccggaggggccgaggaggatagtt
gcaacaccgtatgcgaagaagattgcaaaacaacacagaattgacatcaataaagtggca
gggactgggcccttcgggagaatcacggcggaggatgtagagaaagctgccggaattaca
cctaagaagagcaccgctgcgcctcttcaggctgccgctcctgctgctccgtcccctgct
aaaacttccccatcaagctatcctgagattccaggctcgacagtcgtccctttcacagca
atgcaggctgcggtttccaagaacatgttagatagcctctctgtacccacttttcgtgtt
gggtatcccatttctactgatgcccttgatgctctctatgcgaaggttaagtccaaggga
gtcactatgaccgcattgttagccaaagctgcagcgatggcattggctcaacatccggtt
gtgaatgcaacttgcaaggacgggaagtgttttacttacaatagcagcataaatattgct
gttgcagtgtctattaatggcggattgataacccctgtacttgaggatgctgacaagttg
gacctgtatttgttgtctcaaaagtggaaggaactggtagagaaggctcgggctaaaaaa
cttcaaccacacgagtatagtacagggactttcacattatcaaacctgggaatgtttggt
gtggatagatttgatgctattcttcctccaggccagggagctattatggctgttggagca
tcaaaacctactgttgttactgatgctgacggattctttagcgtcaaaaacaggatgctg
gtaaatgtcacagctgatcaccgaatcatctacggtgctgacttggctgccttccttcaa
acgttttcaaagattgtcgagaaccctgacagtttgacaatgtag

DBGET integrated database retrieval system