KEGG   Ipomoea nil (Japanese morning glory): 109162823Help
Entry
109162823         CDS       T04663                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain SSU11A, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00630  Glyoxylate and dicarboxylate metabolism
ini00710  Carbon fixation in photosynthetic organisms
ini01100  Metabolic pathways
ini01200  Carbon metabolism
Module
ini_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ini_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ini_M00532  Photorespiration
ini_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109162823
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109162823
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109162823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 109162823
NCBI-ProteinID: XP_019167059
LinkDB All DBs
Position
Un
AA seq 178 aa AA seqDB search
MASSVLSSAAISGRATAAKASMVAPFTGLKSTASFPVTRKSADFTSIATNGTRVQCMQVW
PPFGLKKFETLSYLPPLSTEQLLKQVEYLLNKGWVPCLEFETEKGFVYREWHSSPGYYDG
RYWTMWKLPMFGCTDATQVVAELEECKKAYPGAWVRILGFDNRRQVQCIMFIAYKPHD
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcagtcctctcctccgccgccatttccggccgcgccaccgctgccaaggcc
agcatggtcgcacctttcaccggtctcaagtccaccgcctctttccccgtcactaggaaa
tccgccgactttacttccattgcaaccaacggcactagagtacaatgcatgcaggtttgg
ccgccattcgggttgaagaagttcgagacactgtcatacctgcctccattgagcactgag
caattgctcaaacaagtggagtacctgcttaacaaaggatgggttccttgcttggaattc
gagactgagaaaggattcgtataccgtgaatggcacagttcaccgggatactacgacgga
agatactggacaatgtggaagctgccgatgttcgggtgcacggatgcgacccaggtggta
gcagagctggaggagtgcaaaaaggcatacccgggtgcatgggttagaattctgggcttc
gataacaggcgccaagtccagtgcatcatgttcattgcatacaagccccacgactag

DBGET integrated database retrieval system