KEGG   Ipomoea nil (Japanese morning glory): 109167019Help
Entry
109167019         CDS       T04663                                 

Definition
(RefSeq) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ-like
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00061  Fatty acid biosynthesis
ini00780  Biotin metabolism
ini01100  Metabolic pathways
ini01212  Fatty acid metabolism
Module
ini_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109167019
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    109167019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ini01004]
    109167019
Enzymes [BR:ini01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     109167019
Lipid biosynthesis proteins [BR:ini01004]
 Fatty acid synthase
  Component type
   109167019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 109167019
NCBI-ProteinID: XP_019171462
LinkDB All DBs
Position
Un
AA seq 227 aa AA seqDB search
MASTALSQSFFSTLTPHSAASHKTLDNASSLSLNRSLPFKSHPLSTQCDKTRPSFVTKCT
ANESATKTPETPIELSYPSFPSVVDINQIMDILPHRYPFLLVDRVIEYNPGVSAVGIKNV
TINDQFFNGHFPGRPIMPGVLMIEALAQVGGIVMLQPEVGGSRSNFFFAGIDKVRFRKPV
VAGDTLVMRMTLTKLQKRFGIAKMEGKAYVGGDLVCEGEFLMATGSE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctactgctctctcacagtcttttttctccactctcactccccactctgccgct
tctcacaagaccctcgacaatgcttcttccctctcgttgaatcgctcgctgcccttcaaa
tctcaccccttgtcgacccaatgcgataaaacccggcctagtttcgtcaccaaatgtact
gcaaatgaatcggccaccaaaacccccgagacccctattgaattgagttacccttcattt
ccgtctgtggtggatatcaatcagattatggatattctacctcaccgttatccatttttg
ctggtggatagagtgattgagtacaatccgggagtttcagcggttggaatcaagaatgtt
actattaacgaccagttcttcaacggacactttccggggaggccaatcatgcctggtgtt
ctcatgattgaggcactggcccaagttggcgggatagtcatgctgcaacccgaagtagga
ggctcccgtagcaacttcttctttgctggaatcgacaaagtaagattcaggaagccggtg
gtggcgggagatactttggtgatgagaatgacgctcaccaagctgcaaaaacgctttgga
atagcgaagatggaaggaaaagcctatgtgggaggtgacttggtttgcgagggtgagttt
ttgatggccacaggcagcgagtag

DBGET integrated database retrieval system