KEGG   Ipomoea nil (Japanese morning glory): 109175645Help
Entry
109175645         CDS       T04663                                 

Definition
(RefSeq) casein kinase 1-like protein 10
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ini01001]
    109175645
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ini03036]
    109175645
Enzymes [BR:ini01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109175645
Protein kinases [BR:ini01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   109175645
Chromosome and associated proteins [BR:ini03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109175645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 109175645
NCBI-ProteinID: XP_019180500
LinkDB All DBs
Position
Un
AA seq 465 aa AA seqDB search
MDHVIGGKFKLGRKIGGGSFGELYLGVNVQTGEEVAVKLEPVKTKHPQLHYESKLYMLLQ
GGTGIPHLKWFGVEGEYNAMVIDLLGPSLEDLFNYCNRKFTLKTVLMLADQLLNRVEYMH
SRGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHRGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTPIEVL
CKSYPSEFISYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQIGG
SSSRARQPIGRLSLNPGPSAERAEKTPVRQEVRGDRFSGGVEAFARRNSSGTGLHGDHSR
HRTSEDIPSSKDAHADSERGRVSRTGSASRRAVMSSSRPSSSGEPTDSRTGRLGSSSGRL
SSTQRLQPGVESKSSSFARTSATRGGRDDTLRSFELLTIGTGRRK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgtgatcggtggaaagttcaagctgggccggaagattggtggtggatctttt
ggggagctttacttgggagttaatgtgcagactggagaggaagttgctgtgaagctggaa
ccagttaaaactaagcaccctcagcttcattatgaatcaaagctctatatgcttctacag
ggtggaactggaattccccatctcaagtggtttggagtcgaaggagaatacaatgccatg
gttattgacctgcttgggccgagcctcgaagacttgtttaactactgcaataggaagttc
acgttgaaaaccgttctaatgcttgcagatcaattacttaatagggtcgagtatatgcac
tcaagaggatttcttcaccgcgatataaagcctgacaacttcttaatgggtttaggacgc
aaggcgaatcaggtatatattatcgactatggtcttgccaaaaagtatagagatttgcaa
acgcataagcatataccgtatagggaaaacaagaacctaacgggcacggctcgttatgct
agtgttaacacccatcgtggaatcgagcaaagcagaagagacgatctggagtctcttggc
tatgtgctaatgtatttcttgaggggaagccttccctggcaagggctgaaagcgggcact
aagaagcagaaatacgacaagattagcgagaagaaaatgcttacccctattgaggtgctt
tgcaaatcttatccatccgaattcatctcgtattttcattattgccgatcattaaggttt
gatgacaagccagactactcatacttgaagagactcttccgcgaccttttcattagagaa
ggctatcagtttgactatgttttcgattggactatattgaaatatccacagatcggtggt
tccagttctagagcgcgacaacctatagggagattatctttgaaccccggaccatctgct
gaaagagcagaaaagaccccggtgaggcaagaagtccggggggataggttttcgggtggt
gtggaggcgtttgctagaaggaatagctccggtactggtttacacggtgatcattcgagg
cacagaacttcggaggatatcccgtcatccaaagatgcacatgctgattctgaacgagga
cgcgtttctcggactggtagcgcctcgaggagggcggtgatgtcaagcagcaggccgagc
tcctcgggcgagcccaccgacagtcgaactggacgcctgggctcgagcagcgggcgtcta
tcttcgactcaaagattacagcccggggttgagtccaaatcgtcgtctttcgcccgaact
tctgccacgagaggcggtcgtgacgacacgctcagaagtttcgagcttctgaccattggc
actggaagaaggaaataa

DBGET integrated database retrieval system