KEGG   Ipomoea nil (Japanese morning glory): 109176182Help
Entry
109176182         CDS       T04663                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ini00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109176182
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109176182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109176182
NCBI-ProteinID: XP_019181169
LinkDB All DBs
Position
Un
AA seq 152 aa AA seqDB search
MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagggtgtggcagttcttagcagcagtgaaggtgtcagcggcaccattttcttc
acccaagaaggagatggtccaaccacagtcactggaaatgtttcgggcctcaaacctggt
catcatggattccatgtccatgccctaggtgacacaacaaatggatgcatgtctactgga
ccacatttcaatcctgctggaaaggagcatggagctcctgaagacgatatccgccatgcc
ggtgatcttggaaacatcacggttggagaagatggtactgctacattcactatcactgac
aaacagattccgcttactggagcaaattctattattggaagagctgttgttgttcatggt
gatcctgatgatcttggcaaaggtggccatgaactcagcaaaaccactggaaatgctggt
gggagggttgcctgcggtatcattggcctgcagggttaa

DBGET integrated database retrieval system