KEGG   Ipomoea nil (Japanese morning glory): 109176461Help
Entry
109176461         CDS       T04663                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109176461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ini03036]
    109176461
Enzymes [BR:ini01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109176461
Chromosome and associated proteins [BR:ini03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109176461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 109176461
NCBI-ProteinID: XP_019181445
LinkDB All DBs
Position
Un
AA seq 671 aa AA seqDB search
MASLVPFQDLDLQLGPSTFTGGNCSSSGAGSSGMIVPKIEPKLEPLDEFAQADLQTPASF
SNPSPAFNSGFSLAPPRQQSDAGYGSGFSGDDNVYSEFHRISEMFRTAFAKRMQRYGDVE
VVEDPDSRAIVPVNNDGQLSTVVIARRKYQQRSSELVRVTDLSPEDQRYFRDVVRRTRMH
YDSIRVLAPLEDERNQQYGHFKKTRGDLKAAQLMRERGLWLNRDKRIVGSIPGVYVGDLF
FFRMELCVVGLHGQVQAGIDFVSASHSSNGEPIATSIIVSGGYEDDMDSGDVIVYTGHGG
QDKNSRQCNSQKLEGGNLALERSMYYGIEVRVIRGFKYEGSASGKVYVYDGLYRIVDCWA
DVGKSGFGVFKYKLVRIEDQPEMGSAVLKFAETLRTRPLEARPTGYVSLDISRKKENVPV
FLYNDIDTDQEPVYYDYLVKTIFPPHVFQYMGASAGCDCVNGCFGNCFCSIRNGGEFAYD
HNGILLRGKPLVLECGPHCRCPATCRNRVSQKGVRKRFEVFRSRETGWGVRSLDLIQAGS
FICEYAGIVLTKEQEEIFKMNGDSLIYPSRFSERWAEWGDLSQIYPDYVRPSYPSIPPLD
FAMDVSRMRNLACYMSHSSSPNVLVQLVLYDHNYACFPRLMLFAMENIPPLQELSIDYGV
ADDMGKLAICN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctcgtcccatttcaagacctcgatctccagcttggcccgtcgacgttcacc
ggcggtaactgttccagctccggtgccggttcatctggtatgatagttccaaagatcgaa
ccgaagctggaaccgctggacgaatttgcacaagcggatctccaaacccctgcttctttt
tcaaaccctagtcccgcgttcaattcgggtttcagtctcgctccgcctcggcaacaatct
gatgctggatatggctcggggttctctggtgatgacaatgtttactcggaattccatcgg
atttcggagatgtttcgcaccgcattcgcgaagaggatgcagcggtatggcgatgtggag
gtcgtggaagacccggattcgagggctatcgtgcctgtgaacaacgacgggcagctttcg
actgtggtaattgcgaggaggaagtatcagcagcgctcgtcggagctggtgagagtcacc
gatcttagccccgaggatcagaggtatttccgggatgttgttcgcaggacccggatgcat
tacgattctattcgggttctcgcgccgttggaggatgagaggaaccagcaatatgggcat
tttaaaaagaccagaggggacttgaaggccgcacagctgatgagggagaggggactctgg
ctgaaccgtgataagcgtattgttggctccattcctggggtgtacgttggggacttgttc
tttttccgaatggaattgtgtgtggttggattgcacgggcaggttcaggctggaattgac
tttgtttctgccagccatagctctaacggggagcctattgctaccagtattatagtatct
ggaggatacgaggatgatatggattcaggggatgtgatagtctatactgggcacggtggg
caggacaagaactcgcgccaatgtaatagccagaagcttgaaggtgggaatttggcattg
gagaggagcatgtattatggaattgaggtaagggtaatccgtggctttaaatatgaaggt
agtgctagtgggaaagtctacgtttatgatggcttatatagaattgtagactgttgggct
gatgtaggcaagtctggttttggagtgtttaagtataaactcgtaaggattgaggatcaa
ccagaaatgggaagtgctgttctaaaatttgcagagaccctcaggacccggccattggag
gccagaccgacaggatatgtcagtcttgatatatcaaggaagaaagagaatgtgccagtg
tttttatataatgacatagatacagaccaagaacctgtttattatgattatttggtgaag
actatatttccgccacatgtcttccagtatatgggagcttctgctggctgtgattgtgtc
aatggatgttttggcaattgtttctgttcaattagaaatggtggtgaatttgcctacgac
cataatggtatcctgttgaggggaaaaccactggttcttgaatgtggcccacattgtcgt
tgtcctgcgacttgtcggaaccgagtgagtcaaaaaggtgtgaggaaaagatttgaagtg
ttccggtcaagggagacaggttggggagttaggtcattggacctgattcaagctggttct
tttatttgtgaatatgcaggtatcgtcctcacaaaggagcaagaagaaattttcaaaatg
aatggtgatagcttaatttatcctagtcgtttttcagagaggtgggcagaatggggagat
ttgtctcaaatatatccggactatgtacgcccatcatatccttcaattcctcctttggat
tttgcaatggatgtatcccgaatgcggaatttagcctgttacatgagccatagttctagt
cccaatgttcttgtgcagcttgtgctctatgatcacaattatgcctgttttcctcgcctt
atgctctttgccatggagaatatacctcccttacaggaacttagcatcgactatggggta
gctgatgacatggggaagcttgccatctgtaactga

DBGET integrated database retrieval system