KEGG   Ipomoea nil (Japanese morning glory): 109176842Help
Entry
109176842         CDS       T04663                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00052  Galactose metabolism
ini00500  Starch and sucrose metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109176842
   00500 Starch and sucrose metabolism
    109176842
Enzymes [BR:ini01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109176842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 RVT_2
Motif
Other DBs
NCBI-GeneID: 109176842
NCBI-ProteinID: XP_019181784
LinkDB All DBs
Position
Un
AA seq 916 aa AA seqDB search
MAVASSRAWHVHQLDINNAFLHGNLDEEVYMILPPSFQGEKPGQMGNSKNPKLQASLVCS
FLCILLLLIHNSDTANAQDQPGQIGFGYQVISSAVDASGKTLTAQLQVIQNSSVYGPDIV
NLSLVASIETAGRLRVKITDADNQRWEIPDDIIPRTTIANSSSISLAQVAEGGNNQSSIS
DPNSDLVFTLYNTIPFGFSVQRKSSNDTLFDASPVAGSNETFLIFKDQYLQLSSSLPPNT
SSLYGLGEHTKTTFKLLYPQTLTMWAADIPSSNRDMNLYGSHPFYMDVRSLPQPGVTHGV
LLLNSNGMDVVYNGDRITYKTIGGILDLYFFAGPTPELVMEQYTELIGRPAPMPYWSFGF
HQSRYGYANITDVEGVVAGYANASIPLDVMWTDIDYMDAYRAFTFNPVNFPADRMKTFVD
NLHQNAQRYVLILDPGIGINDTYASFTRGMAADIFIKRDGVPYQGQVWPGNVYFPDFINP
AATAYWINEIKLFWDVAQFDGLWVDMNEIANFMTSPSNDSTLDNPPYKINNSGNQRAINE
RTVPATAIHFGNIPEYNVHNLYGFLNARATNLGLINATGKRPFVLGRSTFVGAGKYTAHW
SGDNAASWDDLGFSIPAILNFGLFGIPMGGVDICGFFRSTTEELCQRWIQVGAFYPFARN
HGDKSSNRHELYLWESVAASARQVLGLRYRLLPYFYTLMYEAHTRGVPIARPLFFSFPED
INTYEVYTQFLLGQGVLISPALTEGAVSVEAYFPAGTWYDLFNYTNSTVAETGKNFTLDA
PREKINVHLREGNILALQGAALTTQAARNTSFELLVALGSSGNSSGEVFLDDGEQIEMGG
AGGGWSLVRFQTSGVGANVTLTSEVTNPDFAGNSTWIIEKVTVLGINSSTNSSGVLEIPG
LNLPIGISFTLPLTPQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgcttcctctcgagcctggcatgttcaccaattggacatcaataatgcgttc
ttgcatgggaatttggatgaggaagtctacatgattcttccaccaagttttcaaggagag
aagccaggtcagatgggaaatagcaagaatccaaagctgcaggcttctctagtctgctct
ttcctttgcattttgttgttgttaatacacaacagcgacactgcaaatgcacaagatcag
ccgggacagattgggtttgggtatcaggtcatctcgtcggcggtggatgcctccggcaag
acgttgactgcccagcttcaggtcatccagaactcatctgtttatggacctgacattgtc
aatctcagccttgttgctagcattgagacagcaggtcggctgagagtgaagatcacagat
gcagataatcagagatgggaaatcccagatgatatcattccccgcacaacaattgcaaat
tcttcctccatatccctagcccaggttgcagagggagggaataatcagtcttccatctca
gacccaaactccgacctggttttcaccctttacaacaccattcctttcggcttctccgtc
caacgcaagtcctcaaacgacacccttttcgacgcctcaccggtggcgggttccaatgaa
accttcttgatctttaaggatcagtatctgcagctttcatcgtcactgccacccaacact
tcgtctctgtatgggctgggagagcacacgaagaccacattcaagttgctgtacccccaa
acgctcaccatgtgggctgctgatattcccagctctaatcgcgacatgaatctctatggc
tcccaccctttttacatggacgtgagatccctccctcaacccggggtcacccatggggtc
ttgctgctcaacagcaatggcatggatgttgtgtataatggcgataggattacctataag
accattggtggcattcttgacctgtatttctttgccggccctacgcctgagttggtgatg
gagcagtatacagaactcattggccgccctgctcctatgccttactggtcctttgggttt
caccagtcccgctatggttatgcgaatattaccgacgttgaaggagtggttgctggctat
gcaaacgcctcaataccccttgacgttatgtggactgatattgattacatggatgcttat
agggctttcacttttaatcctgttaattttcccgcggataggatgaagacattcgttgac
aatcttcatcagaatgctcagagatatgtgctcattcttgatccagggattggcattaac
gatacatatgccagcttcaccagaggcatggcagctgatatcttcatcaagcgagatggc
gttccataccagggacaagtctggcctggaaatgtatacttccctgactttataaaccca
gcagccactgcctattggatcaatgaaatcaagcttttctgggatgttgctcaattcgac
ggtctttgggtggacatgaatgagattgctaacttcatgacatctccttccaatgactcc
accctcgacaatcctccctacaagatcaacaactctggaaaccagagggcaatcaatgag
agaactgtccctgcaactgccattcattttggcaatattcccgagtataatgttcacaac
ctctacggattcctgaatgccagagccaccaacttaggcttgatcaatgctactggtaaa
aggccattcgtgctgggtcgatctaccttcgtgggtgctggcaagtacactgcccactgg
agtggtgacaatgctgcgagttgggatgatttggggttcagtattccggccatcttgaat
tttggactgtttgggattcccatgggtggagttgacatttgtggcttttttagaagtaca
acagaagagctttgccagcgctggatccaggtaggggcattctatccctttgcaagaaac
catggtgacaagtccagcaatcgccatgaactttatctctgggaatctgttgctgcatca
gctaggcaagtgctcgggctgcgctatcgtctcctcccatacttctacacattgatgtac
gaagcacacacccggggtgtccccattgcaaggccgctcttcttctcattcccagaggac
atcaacacatatgaggtttacacccagtttctcctgggacagggggtgctcatttcacca
gctctcactgaaggtgcggtttcagtggaggcctatttcccagctggaacctggtatgat
ctcttcaactacaccaactccaccgtggcagaaacggggaagaatttcactctggacgcc
cctcgtgaaaagataaacgtgcatctccgggaaggcaacattctggcactgcagggagcg
gcattgacaacacaggcagcccgcaacacttcgttcgagctgctggtggctcttggcagc
tcaggtaacagctctggtgaggttttcttggacgatggagagcaaatcgagatgggcggt
gcaggaggggggtggagcttagtgcgtttccaaaccagtggagtgggagccaatgtaact
ctcacatcagaggtcacaaatccagattttgcaggaaacagcacttggatcatagagaaa
gttactgttcttggtattaatagcagcaccaactcatctggtgttctggagatccctggc
ctgaatctaccaattggaataagttttacgttgccactcacaccccaatag

DBGET integrated database retrieval system