KEGG   Ipomoea nil (Japanese morning glory): 109177525Help
Entry
109177525         CDS       T04663                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00250  Alanine, aspartate and glutamate metabolism
ini00410  beta-Alanine metabolism
ini00430  Taurine and hypotaurine metabolism
ini00650  Butanoate metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Module
ini_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109177525
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109177525
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109177525
   00430 Taurine and hypotaurine metabolism
    109177525
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109177525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109177525
NCBI-ProteinID: XP_019182443
LinkDB All DBs
Position
Un
AA seq 494 aa AA seqDB search
MVLSRTAVATDASVHSTFASRYVRTSLPRFQMPQMSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDRLIMASINKNYVDMDEYPVTTELQNRCVNMIAHIFNAPLGEGEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKMRAMGKPIDKPNIVTGSNVQVCWEKFARYFEVELIE
VKLRDGYYVMDPEKAAEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKATGWDTP
IHVDAASGGFIAPFIYPDLVWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCQENAMVLKEALEK
TGKFNIISKDVGVPLVAFSLKDNRRHNEFEISDMLRRYGWIVPAYTMPPDAEHVTVLRVV
IREDFSRTLAERLVNDIEKVIHDLETLPARVGARMAADEVTAVPKKTEREVTLEITNAWK
KFVADRKSKKNGVC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtcaaggactgccgtcgcgaccgacgcctccgtccactcaacgttcgcctcc
cgatatgtcaggacgtcgcttcctcgatttcagatgccgcagatgtcgatcccgaaggag
gcggcgtaccagatcataaacgatgagctgatgttggacgggaatccgaggctgaatctg
gcctccttcgtgacgacgtggatggagccggagtgcgataggctcatcatggcttccatt
aacaaaaattacgtcgacatggacgagtatcccgtcaccactgagctccagaatcgatgt
gtgaacatgatagcgcacatcttcaacgcgccgctgggcgagggagaggccgccgtcgga
gtggggacggtcgggtcatcggaggccatcatgctcgccggattagcgttcaagagaaaa
tggcagaacaagatgagagccatgggcaaacccatcgacaaaccaaacatcgttactggt
tccaacgttcaggtatgttgggagaaatttgcaaggtatttcgaggtggagctgatagag
gttaagttgagagatgggtactacgttatggaccctgagaaagccgcagaaatggtggac
gaaaacacaatttgtgttgctgccattttaggatccactctcaatggagaattcgaagat
gttaagcgcttgaacgatctcttggtcgaaaagaacaaggcaaccgggtgggatacgccg
attcatgtggatgcggcgagcggtgggttcattgctccattcatttacccagatctggta
tgggacttcaggctgccgctggtgaagagtattaacgttagtggtcacaagtatgggctt
gtgtatgccggaattggttgggtgatctggagaagcaaggaggacttgcctgaagaactc
atcttccacatcaactatcttggtgctgatcagcctactttcaccctcaacttctctaaa
ggttctagtcaagtgattgcccaatactaccaactaatccgtttgggatacgagggttac
aagaatgtgatggagaattgtcaagagaacgcaatggtactgaaagaagcattggagaag
acagggaagttcaacatcatatcaaaggacgtgggagtcccgttggtggcgttctcgcta
aaagacaaccgccgccacaacgagttcgagatctccgacatgctccgccgctacggctgg
atcgtgccggcgtacaccatgccgcccgacgccgaacacgtcaccgtgctgcgcgtcgtc
atccgggaggacttctcccggaccctggcggagcgcctcgtcaacgacatcgagaaagtc
atccacgacctggaaacactccccgccagggtcggcgccagaatggccgccgatgaggtc
accgccgttcccaagaagactgaacgtgaagtcaccctggagatcaccaacgcctggaaa
aagttcgtggctgatcggaagagcaagaaaaacggcgtgtgttaa

DBGET integrated database retrieval system