KEGG   Ipomoea nil (Japanese morning glory): 109177936Help
Entry
109177936         CDS       T04663                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109177936
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ini03036]
    109177936
Enzymes [BR:ini01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109177936
Chromosome and associated proteins [BR:ini03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109177936
   Polycomb group proteins
    PRC2-EZH2 complex
     109177936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 109177936
NCBI-ProteinID: XP_019182983
LinkDB All DBs
Position
Un
AA seq 913 aa AA seqDB search
MSAPDNTPSSSESDPSNDLQIVAMQDACPVSSEISVVIDCLKRKVSLERDLYIKKRIQEN
TQKLVDVTKELYEMSTERINLKIHGVDGSIDLLSKRQKDAIDMQNGIDTCNGDDDSSSSK
EDGYASAILLGSSIAVKNAVRPIKIPEEKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYY
DENGGETLICSDSDEEVIDEDEEKKDFVESEDYILRMTIKEVGLSDMVLDLLAQCFSRKP
CEVKARYEDLIKEENAVSKNDNAEGTINLYLDKDLDAAMDSFDNLFCRRCLVFDCRLHGC
SQDLIFPAEKPPLLFGADVEKEPCGPNCYRGVIKPEGNSKMTPLHLCSHEDKPVPSSDGA
TVQLPVRKHVEKRSKSSPSESASSTAKNTSESSDSETRPISDVTSVHRSASPCRGKESKG
GNNKRNSKRIAEKVILAIRKRQKKSTASESDAVAVASGSSKSSSHRSLKDNENISSSSQK
EQSNSSRKSRRKVSPLMDANKSSHCEALFSTQNDVISDRPVTNNEIQMEDESVNEIILKK
EVNEDISWRPIEKALFEKGLEMFGRSSCLIARNLMNGQKTCLEVFQYMNHSENKLSTRIG
DGVDCMLEGGSKGDEIVGSEARRRSRFLRRRGRVRRLKYTWKSAGYHAIRKRISEKKDEP
CRQYNPCGCQSPCGKECPCIVNGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPCFAA
GRECDPDVCRNCWIGCGDGSLGIPLQRGDNYECRNMKLLLKQQQRILLGRSDVSGWGAFI
KNSVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNNQFVLDAFRKGDKLKFAN
HSPNPNCYAKVLMVAGDHRVGIFANERISAGEELFYDYRYDPDRAPAWAKKPEASSSKKD
DAAPSSGRARKHT
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgcccgataatactccctcctcgtccgaatcggacccttcaaacgatcttcag
attgtggcaatgcaagatgcatgtccagtatcaagtgaaatatctgttgttatcgattgc
ttgaagagaaaggtttccttggaacgtgatttgtatataaagaaaaggattcaggaaaat
acacagaagcttgttgatgtaacaaaagagctttatgaaatgtcaacagaaaggataaat
cttaagattcatggtgtagatggaagcattgatctactgtcaaagaggcagaaggatgct
attgatatgcaaaatggcattgatacttgtaatggagatgatgacagcagtagctctaag
gaagatggttatgcttctgcaattcttttaggatctagcattgcagtaaagaatgctgtt
cgcccaattaaaattccagaagagaaaagactacctccttatactacttggatatttttg
gatagaaaccaaaggatgactgaagatcagtctgtagtaggtcgaagacgaatctattat
gacgagaatggcggagaaactctaatttgtagtgacagtgatgaagaagtaattgacgag
gatgaagaaaaaaaggactttgtagagtctgaagactatattttgcgaatgactatcaaa
gaggttggcttgtctgatatggtgctggatttgctggctcagtgcttttctagaaagccc
tgtgaagtgaaggccagatatgaagatcttatcaaggaagaaaatgctgtttctaagaat
gataacgctgaaggcactataaatttgtatcttgacaaagatcttgatgcagctatggat
tcatttgacaatctattctgccgtcgatgcctggtctttgattgtagattacatggatgt
tcacaggatcttatctttccggctgaaaaaccacctctgttgtttggagctgatgtagaa
aaggaaccttgtggccctaattgttatcgtggggtcataaaaccagaaggtaactccaaa
atgacccctttgcatctatgtagtcacgaagataagcctgtcccatcatctgatggtgct
actgttcagttgcctgtgaggaagcatgtggagaaaagatcaaaatcttcccctagtgaa
agtgcttcatctactgccaaaaacacatctgaaagtagtgactcagagactaggcctata
agtgatgtcacttctgtgcaccgttctgcatcaccatgtagaggtaaagaaagtaaaggt
ggaaataataaaagaaacagtaagcgtattgcagagaaagttattcttgccataagaaag
aggcaaaagaaatcaacagcttctgagtctgatgctgttgctgttgcaagcggaagttca
aaaagttcgagccatcgttcactcaaagacaatgaaaacattagttcttcctcacaaaaa
gagcaatctaacagtagtagaaagtctaggaggaaagtatctccacttatggatgctaac
aaatcttcccattgtgaggcacttttttcaacccaaaatgatgttataagtgaccgacca
gtgacaaacaatgaaattcagatggaagatgaatctgtaaatgagattattttgaagaaa
gaagtaaatgaagatatatcttggagaccaattgagaaggctctctttgaaaagggcttg
gagatgtttggtagaagcagctgtttgattgctcgcaatctcatgaatggtcagaagaca
tgcttggaggttttccagtatatgaatcactctgagaataagctatccactcgaataggt
gatggagtagactgcatgcttgaaggtggctccaagggcgatgaaattgtgggtagtgaa
gcacgaagacgatcaagatttttgcgtaggagaggtagagtccgtcgtttaaaatacaca
tggaaatcagcaggataccatgcaattaggaagcgaatatctgagaagaaggatgagcct
tgtcggcagtataatccttgtggttgtcaatctccctgtggaaaggagtgtccttgtatt
gtaaatggtacctgctgcgaaaaatactgtggatgtccaaagacttgcaagaatcgattc
agaggttgtcactgtgccaaaagtcagtgtcgaagtcgtcaatgtccttgttttgctgca
ggcagggaatgcgatcctgatgtttgccgaaattgctggattggctgtggtgatgggtct
cttgggattcctttacaaaggggtgataattatgaatgtcggaatatgaagttacttctc
aaacaacagcaaaggattcttcttggaagatctgatgtatctggttggggagctttcata
aagaatagcgttagcaagcatgagtaccttggggagtacactggtgaattaatttctcac
cgggaagctgataagcgtggaaagatctatgatcgtgaaaattcttcgttcctcttcaat
ctaaataatcagtttgtgcttgatgctttccgaaaaggtgacaaattgaagtttgccaac
cattctcccaatccaaattgttatgcaaaggtcctcatggtggccggagatcatagggtt
ggtatatttgcaaatgagcgtatctctgccggagaagaactgttttatgattatcgttat
gatccagatagagctcctgcctgggcaaagaaacccgaggcatcgagctccaagaaagat
gacgctgcaccttccagcggtcgtgctaggaaacatacataa

DBGET integrated database retrieval system