KEGG   Ipomoea nil (Japanese morning glory): 109178865Help
Entry
109178865         CDS       T04663                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00010  Glycolysis / Gluconeogenesis
ini00030  Pentose phosphate pathway
ini00051  Fructose and mannose metabolism
ini00052  Galactose metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01200  Carbon metabolism
ini01230  Biosynthesis of amino acids
ini03018  RNA degradation
Module
ini_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109178865
   00030 Pentose phosphate pathway
    109178865
   00051 Fructose and mannose metabolism
    109178865
   00052 Galactose metabolism
    109178865
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    109178865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ini01009]
    109178865
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ini03019]
    109178865
Enzymes [BR:ini01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     109178865
Protein phosphatases and associated proteins [BR:ini01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109178865
Messenger RNA biogenesis [BR:ini03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     109178865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 109178865
NCBI-ProteinID: XP_019183963
LinkDB All DBs
Position
Un
AA seq 478 aa AA seqDB search
MAYSSVNVNGGGGGNLHGEEDGDGHHLISIPKVKLQSIAHLADYLPEQTLQTQTNPLSSN
PFYHAVPGFYLSAGDVVLQQSTFDLSGAFPSSTPPLAYLRAGPRKQIFFEPGRVRAAIVT
CGGLCPGMNTVIRELVVGLWEMYGVREIFGIKSGYRGFYSFEPLRLDPKMVDGWHRNGGT
MLETSRGGFDLHKIVDAIQNRGFNQVYIIGGDGTMRGAVDIFNEIERRKLYVSVVGIPKT
VDNDVGIIDRSFGFQTAVEMAQQAINAAHVEAVSAVNGIGLVKLMGRSTGHIALHATLSS
RDVDCCLIPENQFYLEGEGGLFQFLECRLKRSGHAVVVVAEGAGQDMIPRSESQRQERDE
SGNPVLLDVGAWLKAELKSWWGRSHPNELFTIKYIDPTYMIRAVHANAPDNLYCTLLAHA
AIHGVMAGYTGFVCGPVNGNYAYIPVSEVARAKNKVDTRDHKWSWVRSVTNQPDFLTT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactcgtcagtcaacgtaaacggcggcggtggcggcaatcttcacggggaagaa
gacggcgatggccaccacctcatttccataccaaaggtgaagctacagagcattgcgcac
ctcgccgactacctgccggagcaaaccctccaaacccaaaccaacccactgagcagcaac
cccttctaccacgccgtcccgggcttctacctttccgccggcgacgtcgtcctccagcag
agcaccttcgacctctccggagccttcccttcctccacgcctccgttggcctacctccga
gccgggccacggaagcaaatcttctttgagccggggcgagttcgggccgccatcgtcacc
tgcggcgggctctgccccgggatgaacactgtgatccgggagctggtggtggggctgtgg
gagatgtacggcgttcgggagattttcgggattaaatccgggtaccgcgggttctactcc
tttgaaccgctccggctcgacccgaaaatggtggatggttggcacagaaatggcggcacc
atgcttgagacatctagaggcggatttgatcttcacaagattgttgatgccatccaaaat
cgaggctttaatcaggtttacatcatcggtggagatggaacaatgcgtggggcagtggat
atattcaacgaaattgaacgcaggaaactgtatgtttcagttgtagggatcccaaaaaca
gtagacaacgatgtcggcattatcgacagatcattcgggttccaaacggcggtggagatg
gcgcagcaagccatcaatgcagcccatgtagaagccgtgagtgcagtgaatggaataggg
ttggttaagctcatgggacgcagcaccggacacatcgcgctgcacgcaactttaagcagc
cgagacgtggattgctgtctcatcccagagaaccagttttacttagaaggagagggaggc
ctcttccaattcctcgaatgccgcctgaagcggagcggccacgccgtcgttgtggtggcg
gagggagccggacaggacatgattccaagaagtgaatctcaaagacaggaaagagacgag
tcaggtaatcctgtgttgttggatgttggggcgtggttgaaggcggagctgaagagttgg
tggggtaggagtcacccgaatgagctgttcacgataaagtatattgatccaacgtacatg
atccgggctgttcatgcaaacgcaccggataatctatactgcactctcctcgcccacgct
gcaattcacggcgtaatggcaggctacaccggctttgtgtgtggtcctgtgaatggaaac
tatgcgtatattccagtgagtgaagttgcaagagccaagaataaggtggatacaagggat
cataaatggtcatgggtccgatcagtcaccaatcagcctgattttcttacaacttaa

DBGET integrated database retrieval system