KEGG   Ipomoea nil (Japanese morning glory): 109179393Help
Entry
109179393         CDS       T04663                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Brite
KEGG Orthology (KO) [BR:ini00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ini01001]
    109179393
Enzymes [BR:ini01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109179393
Protein kinases [BR:ini01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   109179393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH Pkinase_C RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 109179393
NCBI-ProteinID: XP_019184433
LinkDB All DBs
Position
Un
AA seq 470 aa AA seqDB search
MVSAKFSQLPGKKPLQNNALLPLKPPDVKALDNVDLEFSDVFGPVPAQSPIYENVAVPDT
IGLAYEDPTVVYSRSHSFVGPTTCINQTQRLSRLTLRENDDSLVLVDKVCEEANGKRQSS
FENSIAGDSTVQERSLLPKSVGLEDFEVLKVVGQGAFGKVYQVQKIDTSEIFAMKVMRKD
KVLDKSQTEYMISERNILTKIDHPFIVQLKYSFQTKYRLYLVLDFVNGGHLFFQLCRQGL
FREDLARIYTAEIVSAVSHLHDKGIIHRDLKPENILLDAEGHVVLTDFGLAKQFDENSRF
NSLCGTVEYMAPEIILGKGHDKAADWWSVGVLLYEMLTGKPPFFGGNRQKVQQKITKDKI
KLPAYLSSDAHSLLKGLLQKEARKRFGSGPKGSDEIKSHKWFRSINWKKLEAREIQPSFC
PEVAGKHCVANFEERWTAMPLLESPAASPKGCENPFRGYSFMRPDLHSCK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtttctgctaagttctcacagttaccggggaagaaaccccttcagaataatgcgctt
ctcccgttgaaaccacctgatgtcaaggcactggataatgttgatttggagttttctgat
gtctttggtcctgttccagctcagtcaccaatctatgaaaacgttgcggtgccagataca
attggattggcttatgaagacccgactgtagtttacagtcgctctcattcttttgttgga
ccaacaacctgtattaatcagacacaaaggctcagcagactcacattacgtgagaatgat
gactctctggtacttgtagacaaagtctgtgaggaggctaatggaaaacgtcaatcttct
tttgagaattctattgctggggattccactgttcaggagcgcagtcttttaccaaaatca
gttggacttgaagactttgaagtgttaaaagttgttggccaaggtgcatttggaaaagtt
tatcaggtgcagaagattgacacctcagaaatcttcgcaatgaaggtcatgcgaaaggat
aaggttttggacaaaagtcaaactgagtacatgattagcgagaggaatatactgactaaa
atagatcaccctttcattgtgcagcttaaatactctttccagactaaatacagactctac
cttgttttggattttgttaacgggggacatcttttctttcaactctgccgtcaaggctta
ttcagagaggatttagcacggatctatactgctgagattgtttccgctgtttctcacctc
catgataagggaataatacacagggatcttaaacccgaaaatatacttttggatgcagag
ggtcatgttgtactgaccgactttggtcttgcaaagcaatttgatgagaactcgcggttt
aactctctgtgcgggacagtggagtatatggcacctgaaattattcttgggaagggccat
gataaggctgcagactggtggagcgtgggagttctactatatgagatgcttacaggaaag
cctcccttttttggtgggaaccggcagaaagttcagcagaagatcacaaaggacaagatc
aagctccctgcatatttgtcaagtgatgcacattccctgttaaaagggctactacagaag
gaggcacggaagcgctttggcagtggaccaaaaggtagcgatgagataaagagccacaag
tggttccgttccatcaactggaagaaactagaggctcgagaaatccagccaagtttctgc
cccgaagttgcagggaaacactgcgttgcaaactttgaggagcggtggaccgccatgcct
ctgttagagtctccagctgccagtccgaaaggctgtgagaaccctttcaggggttatagt
tttatgagacctgacctccattcctgcaaataa

DBGET integrated database retrieval system