KEGG   Ipomoea nil (Japanese morning glory): 109182070Help
Entry
109182070         CDS       T04663                                 

Definition
(RefSeq) uncharacterized LOC109182070
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00270  Cysteine and methionine metabolism
ini01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    109182070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ini03032]
    109182070
   03036 Chromosome and associated proteins [BR:ini03036]
    109182070
Enzymes [BR:ini01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     109182070
DNA replication proteins [BR:ini03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    109182070
Chromosome and associated proteins [BR:ini03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109182070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 109182070
NCBI-ProteinID: XP_019187651
LinkDB All DBs
Position
Un
AA seq 1079 aa AA seqDB search
MLSVMSNKGFDSDRRNDAVAVPDLRASTASSSAAVNGEVSSVSTHSGDAKASEDVENGGG
MDLDRGVSLVSDDSAIRNEDRKLNAEEGKELGSEVVNLEDKGGTELIHGFGNSIIDDERS
NGTEGNSVVSEYDLMLSKFDDFAANGRRWTVGLGFEMGDMVWGKVKSHPWWPGHIFNEAF
ATTSVQRSRKDDHILVAFFGDSSYGWFEPADLVPFDSNFHEKSQQTNSRSFAKAVEEAVE
ELSRRCALGLLCRCSRQVDSFRPLPDDEGFFKVDLSDTDTNFVYTASQIKKARESFHPRE
TLTFAKKLALTPMSGDYGNINFIKNRATALAYRKAVFAPHDPTYAEAFGAHVPKHLQQSQ
SKPSKEPQRASLSGRLISMEAMGKGKTSVRHNKATGQTEKDRYLFKRRDEPENLKSRKVA
EVQAGSSSQPIHVDSSVFLGKGSSASVNDNTKSTSGATSIEELKQPPKQDAAVGELHRSG
QVQDCVGEMHISAPTEAKPQGEGFRVRSHGGAQKVKNRKRPASGSETNQLLEKKKKKKKK
ILSMNEGSNLVEKQVGGAVERIVNQKSEGDSVPVPSGTREDIQMDNQQKGDGASISSNEQ
AVPQQAIGIKSVELELPQVLCDLQTLALNPFHGMERSCPTSTRSVFLRFRSLVFQKSLAS
SPAENESNQVPSSKLPASDGAPAERIREAAPVKMPPKPSARPDDPTRGGRKRSPSDRQEE
LSAKKKKKMNDLKLLAAEKKGPQRASEVPKSEMVTKMPSSIPTKLSKPDVSKRIEHSPRV
PEPTMLIMKFPPNGALPSIPELKAKFARFGPLDHSGTRIFWKSSTCRLVYRYKHHAESAL
KFAESSTNLFGNTDVKCSLREAEAAETSISKVSSREDSYALGGSQSKDLMSDRLPPASRQ
LQQQQQQPVQLKSCLKRPPGGGEEAAAGNGNNRGTTPRVKFDLGGEDSSRGELLMSMSND
SKNTKTGSAASSSSDSTTNIKNFSKVIPPPSPSPQLTAQFQNPPTTNVHLPEVVMPHRNM
HNFNTHPHHASSSAPPPPPPLASTTNIDISQQMISLLTKCHEVVTNLTNVLGYPSYRPL
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagtgatgagcaacaaagggttcgattcagatcgcagaaacgacgccgtcgct
gttccggatcttagggcgtccactgcctccagctccgctgctgtaaatggagaggtgagc
tcggtttcgactcactcgggagacgccaaggcttctgaggacgtcgagaatggtggcggt
atggatttggataggggtgttagtttagttagtgatgatagtgcaattagaaatgaagat
agaaaattaaatgcggaggaggggaaggaattgggttctgaggtagttaatttggaggac
aagggtggaacagaactgattcacgggtttggaaatagtataatcgatgatgaaaggagt
aacggaaccgaggggaactctgttgtttccgaatatgacctaatgctttccaagtttgac
gattttgcagccaatgggaggcgatggactgttggtttgggttttgaaatgggggacatg
gtttggggaaaggtgaagtctcacccatggtggccaggccacattttcaatgaggcattt
gcaaccacttcagttcaaagaagtaggaaggatgatcatatattagttgctttctttggt
gatagcagctacgggtggttcgaaccagccgaccttgtaccctttgactctaattttcat
gagaaatctcagcaaaccaattcgaggtctttcgccaaggctgtcgaagaagctgttgaa
gaattgagcaggaggtgtgctctgggtttgctttgtaggtgcagcaggcaggtggacagt
tttcgacctctccccgatgatgaaggttttttcaaagtcgatttgagtgacactgatacc
aattttgtttatactgccagccagattaaaaaagccagggaaagttttcaccccagagag
actcttacttttgccaagaaattagctctcacacctatgagtggtgactatgggaatatc
aactttataaaaaacagggctactgctttagcttatagaaaggcagtctttgcacctcat
gaccctacatatgcagaagcttttggtgctcatgtacctaaacacttgcaacaatcacag
tcaaaaccatcaaaggagccacaaagagcttctctgagtggcagactaatttctatggaa
gccatgggtaagggaaaaacttcagtgagacataacaaggctacaggtcagactgagaaa
gacagatacttgtttaagcgcagagatgaacctgagaacctgaaaagccgcaaagttgct
gaggtgcaagcaggttcctctagccagcctattcatgtagacagctctgtttttttgggg
aaaggttcttctgctagtgtaaatgataatacaaaatccacttctggggccacttctatt
gaagaactaaagcaacctccgaagcaagatgctgctgtaggggaattacatagaagtgga
caagttcaagattgtgttggtgaaatgcatatttcagctcctactgaagcaaaacctcag
ggtgaaggatttagagtgcgttctcatggtggggcacaaaaggtaaagaatcgtaaacgt
cctgcaagtggttctgaaaccaatcaattgttggagaagaagaagaaaaagaagaagaaa
attttaagcatgaatgagggctctaatttggtggagaagcaagtaggtggtgctgtagaa
agaattgtgaatcagaaatctgaaggagattcagtgccagtaccttcaggtactagggaa
gatattcagatggacaatcagcaaaagggtgatggagcaagcatctcctcgaatgagcag
gcagttcctcagcaagcaatagggattaaaagtgttgaacttgaactccctcaagtacta
tgtgatttgcaaactcttgctcttaatcccttccatggaatggaaagaagttgtcctaca
agtacacgtagtgtctttttgcgttttcgttctcttgtatttcagaagagcttggcatca
tcaccagctgaaaatgaatcaaatcaagttccttccagtaaattacctgcttccgacggt
gcacctgctgagcgaattagagaagcagctcctgtgaagatgccgccaaaaccttctgcg
aggcctgatgaccctacaaggggtggtcgtaagcgcagcccatcagataggcaggaggaa
ctttctgccaaaaagaagaaaaaaatgaatgatttgaagctattggctgcagaaaagaag
ggtccccagagagcttctgaagtgccaaagagtgaaatggtcaccaaaatgccatcttca
attccaactaaactgtccaagcctgatgtcagcaagaggatagagcattcaccaagggtg
cctgagccaaccatgctgatcatgaagttccctccaaatggggctcttccatctattccc
gagctcaaagcaaagtttgcccgcttcgggcctcttgaccattctggtacacggattttc
tggaagtcctcaacttgccgtcttgtgtatcggtacaagcatcatgctgagtctgcactt
aaatttgcggagagtagcacgaatctgttcggcaacacagatgtgaagtgctccctgcgc
gaagctgaggcagccgagactagtatttccaaggtgtcgtcgagggaagacagttatgct
cttggaggttcacagtcaaaagatttgatgagtgataggctgcccccggcaagtaggcag
ttgcagcagcagcagcagcagccagtgcagctgaagtcatgtctgaaacggcccccagga
ggaggcgaggaagcagcagcagggaatggtaacaatagaggtactactcctcgtgtaaaa
tttgatttgggtggagaagatagtagtagaggggagctgttgatgtcgatgtcaaatgat
agtaagaacaccaaaactggtagtgctgcttcatcatcttctgattctactactaatatc
aaaaatttctcaaaggttattcctcctccatcgccctctcctcagttgactgctcaattt
caaaacccaccaactactaatgtgcacttgccagaagtggtgatgcctcacagaaatatg
cataattttaacacccatccccatcatgcttcttcatctgctcctcctcctcctcctcca
ctggctagtaccaccaatattgatatttcccaacagatgataagccttctcacaaagtgc
catgaagttgtgaccaatttgacaaacgtactgggctacccatcttaccgtcccctctaa

DBGET integrated database retrieval system