KEGG   Ipomoea nil (Japanese morning glory): 109188324Help
Entry
109188324         CDS       T04663                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00564  Glycerophospholipid metabolism
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109188324
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109188324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Pyr_redox GIDA 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-GeneID: 109188324
NCBI-ProteinID: XP_019194496
LinkDB All DBs
Position
Un
AA seq 628 aa AA seqDB search
MSTAIRLRRLGTIAALSAGAYALLREPPFSSNDHAGMSALETVQRRIADPFAVLPSRADQ
EAALIGSTAANPLDILVVGGGATGSGVALDAATRGLRVGLVEREDFASGTSSRSTKLIHG
GVRYLEKAVFNLDYGQLKLVFHALEERKQVIGNAPHLCNALPCMTPCFDWFEVIYYWAGL
KMYDLVAGRHLLHLSRYYSANESIELFPTLARNGKDKTLKGTVVYYDGQMNDSRLNVSIA
LSAALAGAAVLNHAEVVSLLKDENSGRITGARIRDNQSGKEFDTYAKVVVNAGGPFCDFV
RKLADTNAKPMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDS
NTIITMLPEPHEDEIEFILDAISDYLNVKVRRTDVLSAWSGIRPLAVDPNAKDTANISRD
HVVTEDFPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLTPNNQCLTYNLQLIGADGWEPA
SFTILAQQYVRMKRSHGGKVVPGVMDTASAKHLSHAYGSLAEKVAAIAQNENLGKRLAHG
YPFLEAEVAYCARHEYCESAVDFIARRCRLAFLDTDAAIHALPRVIEILAAEHKWNKSKQ
NQEFQKGREFLETFKSSKNAQFHDGKHT
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgccattcgcctgcgtcgactcggcactatcgccgccctttccgccggagcg
tacgctctcctccgcgagcctccattctcctccaatgaccacgccggtatgtctgccctt
gagactgtgcagcggagaatcgccgaccccttcgccgtcctgcctagccgagcagatcag
gaggcggctttaattggctccaccgccgctaatcctctcgatatactcgttgtcggtggt
ggcgccaccggcagcggcgtcgccctggatgctgccacccgtgggctccgagttggcctt
gttgagcgcgaggatttcgcttctggcacctcctccaggtctactaaactaattcacgga
ggagtccgctatttggagaaagctgtttttaacttggactatggccagttgaagcttgtt
tttcatgccctcgaggaacgtaaacaggttattggcaatgctccacacctctgcaatgct
ttgccttgcatgacaccatgttttgattggtttgaggtgatatactactgggcgggcttg
aaaatgtatgatctggtcgcaggacgacatttgctgcacttgtccagatattattctgca
aatgagtctattgaattatttccaacacttgcaagaaatggtaaagataaaacgctaaag
ggaacagtggtatattatgatggacagatgaatgactcaaggctgaatgtttcaatagca
ctgtctgctgcattagctggagctgctgttcttaaccatgctgaagtagtatcacttctc
aaagatgagaatagtgggcggataactggtgcccgtattcgggacaaccagtcaggaaag
gaatttgacacatatgcaaaagtagttgtgaatgcgggtgggccattctgtgattttgta
agaaagctggctgacaccaatgcaaaacctatgatctctcccagtagtggtgtacatatt
gtgcttcctgattactattctccggaggggatgggtttaattgtccccaaaacaaaagat
gggcgtgttgtctttatgcttccttggttggggagaacagttgctggtaccactgattca
aatacaattattacaatgctgccagaacctcatgaagatgagattgaattcatattagat
gccatttctgattatcttaatgttaaggtgcggcgaacagatgttctctctgcctggagc
ggtatccgccctctagctgtggatcctaatgctaaggacacagctaacatatccagagat
catgttgtcactgaagatttccctggtttagttactattactggtggaaagtggacaaca
tatagaagcatggcagaagatgcagttgatgctgctataaagtcaggaaagttgacccca
aataatcaatgtttaacatacaacctacaactcataggtgcagatggatgggagcctgca
tcttttacaatccttgctcagcaatatgtacgcatgaaaaggtcacatggtgggaaggtt
gttccaggcgtgatggacacagctagtgccaaacatttatctcatgcatatggttctctt
gctgaaaaagtggctgctatagctcagaatgaaaatttgggtaagagacttgcccatggg
taccctttcctagaagctgaggttgcatattgtgctcgccatgaatactgtgaatctgca
gtggatttcattgctagaaggtgtcgtcttgctttccttgacactgatgctgcaatacat
gctttgccacgtgttatagagattttggcagctgaacacaaatggaacaagtccaaacag
aatcaagaattccaaaagggaagggagtttttggagactttcaagtcatcaaaaaatgca
cagttccatgatgggaagcacacataa

DBGET integrated database retrieval system