KEGG   Ipomoea nil (Japanese morning glory): 109191192Help
Entry
109191192         CDS       T04663                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00010  Glycolysis / Gluconeogenesis
ini00053  Ascorbate and aldarate metabolism
ini00071  Fatty acid degradation
ini00280  Valine, leucine and isoleucine degradation
ini00310  Lysine degradation
ini00330  Arginine and proline metabolism
ini00340  Histidine metabolism
ini00380  Tryptophan metabolism
ini00410  beta-Alanine metabolism
ini00561  Glycerolipid metabolism
ini00620  Pyruvate metabolism
ini00903  Limonene and pinene degradation
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ini00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109191192
   00053 Ascorbate and aldarate metabolism
    109191192
   00620 Pyruvate metabolism
    109191192
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109191192
   00561 Glycerolipid metabolism
    109191192
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109191192
   00310 Lysine degradation
    109191192
   00330 Arginine and proline metabolism
    109191192
   00340 Histidine metabolism
    109191192
   00380 Tryptophan metabolism
    109191192
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109191192
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109191192
Enzymes [BR:ini01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109191192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109191192
NCBI-ProteinID: XP_019197325
LinkDB All DBs
Position
Un
AA seq 535 aa AA seqDB search
MASRRLSTLLSRSLSFPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIIN
GKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSR
IMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPA
DGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGK
LFHEAGLPPGVLNIVSGYGPTAGAALASHMEVDKLAFTGSTDTGKIVLELAAKSNLKPVT
LELGGKSPFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARA
MRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIF
SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL
RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgcagactttctaccttgctttctcgttcactctcttttccttctgcatct
gcttttctggggtggaagtatggtgtagaaagtggcatacaaaggttcagcactgcagcc
gcagttgaggagttagtttctccggctgtggaagttaaatacacccaacatataatcaat
ggcaaatttgtagattcagcttctggaaaaacattcccaaccttggatccgagaactgaa
gatgtcattgcacatgtagcagagggtgaagcggaagatataaaccgcgctgtagcagct
gcccgcaaggctttcgatgagggaccttggcccaaaatgagtgcatatgagagatcgcgg
ataatgttgaagtttgctgatttggtcgagaaacacatggatgaacttgcaacattggag
acgtgggacaatgggaagccatacgagcaggctgctaaatcagagttgcccatgattgta
cgcctatttcactactatgcaggatgggcggataaaatccatggtttaacagttccagct
gacggaccacaccatgtccaaaccttgcatgaaccaataggagttgctggccaaattatc
ccatggaacttccctcttgccatgtttgcttggaaagtcgggcctgcgttagcttgtggg
aataccgttgtcctaaagactgcagagcaaacaccattaaccgcactttatgctgggaaa
ctattccatgaggctggtcttcctcccggtgtcctaaacattgtgtctggatatggtcca
actgctggtgctgctcttgctagccatatggaagtggacaagcttgctttcactggatca
actgatactggcaaaatcgtactggaactggctgcaaaaagcaatctgaagccagttaca
ctagagctcggagggaaatcgcctttcattatatgcgatgatgctaatattgatagagcc
gtggaggatgcacactttgcactgttcttcaatcagggccaatgttgctgtgctggttct
cgtacatatgttcatgaacgcatatacgacgagtttgtagagaaagcaaaggcgcgggca
atgagacgcgttgtgggtgatcccttcaaaaaaggtgtagagcaagggcctcagattgac
tcggagcaatttgagaaggttcttaggtacattagatcaggtaaggagagcggtgccacc
cttgaatgtggaggcgacagaatcggatcaaaaggttatttcattcagcccaccattttc
tctgatgtcaaggaggatatggtgatagcacaggacgagatctttggccctgtgcaatgt
gtcctaaaattcaaggacattgatgaagtaataaagagggcgaacaacacgcattatggg
cttgcggccggagtttacacgagcgacattgataaggcaaacactctagctcggggattg
agagctgggactgtgtggatcaactgctatgatgtgtttgatgcgacgattccttttggt
gggtacaagatgagtggcattgggagggagaagggtgtgtatagccttaacaactactta
caggtgaaggctgttgttactcccctcaagaacccagcctggatttaa

DBGET integrated database retrieval system