KEGG   Ipomoea nil (Japanese morning glory): 109192424Help
Entry
109192424         CDS       T04663                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00220  Arginine biosynthesis
ini00250  Alanine, aspartate and glutamate metabolism
ini00710  Carbon fixation in photosynthetic organisms
ini01100  Metabolic pathways
ini01200  Carbon metabolism
ini01210  2-Oxocarboxylic acid metabolism
ini01230  Biosynthesis of amino acids
Module
ini_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109192424
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109192424
   00220 Arginine biosynthesis
    109192424
Enzymes [BR:ini01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     109192424
Amino acid related enzymes [BR:ini01007]
 Aminotransferase (transaminase)
  Class I
   109192424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109192424
NCBI-ProteinID: XP_019198607
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MRRFVAEKARNLVAQAVSYPPSSVFPRRTSSPLRFLSGTSTTPLPSPSSDSMAGSDYSST
PLTLQSINPKVLKCEYAVRGEIVNLAQKIQEELQAKPGSHPFDEIIYCNIGNPQSLGQQP
ITFFREVLALCDHPSILDKSETQGLFSADSIERAFQILDQIPGRATGAYSHSQGIKGLRD
TIASGIEARDGFPANPNDIFLTDGASPAVHMMMQLLISSENDGILCPIPQYPLYSASIAL
HGGTLVPYYLDEATGWGLEISELKNQLETAKSKGIKVRSLVVINPGNPTGQVLAEANQKE
IVDFCKKEGLVLLADEVYQENVYVPDKQFHSFKKVARSMGYGEKDISLVSFQSVSKGFYG
ECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESFSAE
KDAILSSLARRAKTLEDALNSLEGITCNKAEGAMYLFPRIRLPEKAIKAAEAAKTAPDAF
YARCLLNATGVVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVSRLTEFHQRFMDQYRD
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtggccgaaaaagctagaaaccttgttgcgcaagccgtctcttatcct
ccttcttccgtgtttccgcgtcgcacttcgtctccgttgcgtttcctcagcggtactagt
acgactccccttccctctccttcctccgattcaatggcgggttctgattattcgtccact
cccctcactcttcaatccatcaatcccaaggttctgaaatgcgagtatgctgttcgtggt
gaaattgtcaaccttgctcagaaaatacaagaagagttacaggcaaaaccaggttctcac
ccatttgatgagataatttattgcaatattggaaaccctcaatcccttggtcagcagcca
attactttctttagggaggtgcttgcattatgtgaccatccttccattttggataaaagt
gaaactcaaggcctgttcagtgcggactccatagagcgagctttccagattcttgatcaa
attccaggaagagcaactggtgcatacagccatagtcagggtatcaaaggattgcgtgat
acaattgcttctggtatagaagctcgtgatggtttccctgccaatccaaatgacattttc
ttgactgatggtgcaagcccagcggttcacatgatgatgcagctgttgattagttcagag
aatgatggaattctttgtcccatccctcagtatccactttactctgcttcaattgctctc
catggtggcactcttgttccttattaccttgacgaggcaactggatggggacttgagatc
tcagagcttaagaatcagctagaaactgccaagtccaagggaattaaagtcaggtcattg
gttgtgataaatccgggaaatccaacagggcaggttcttgctgaggctaaccaaaaggaa
attgtggatttctgcaagaaagaaggtcttgtacttctggcagatgaggtgtaccaagag
aatgtctatgtgcccgacaaacagttccactcgtttaagaaagttgcccgttctatgggt
tatggagagaaggatatttctttggtatcttttcagtctgtctctaaaggcttctatgga
gaatgtggaaagcgaggaggttacatggaagtgactggctttagtcctgagataagggaa
cagatatacaaagttgcatctgtaaatctatgttctaacatttctggccagattcttgcc
agcctcgtcatgagccccccaaaggtcggagatgaatcctacgagtctttttctgctgag
aaagatgcaatactctcatccttggcaaggcgtgcaaagacactcgaagatgccttaaac
agtctggagggaatcacatgcaacaaagcagaaggagctatgtaccttttccctcgtatt
cgtcttcctgagaaagccataaaggcagcagaagcagctaagactgctccggatgcattc
tatgctcgctgcctacttaacgctactggagtagttgtcgtcccaggctctggctttcga
caggtccccgggacctggcattttaggtgcacaatattgccccaagaggataaaatacca
gctattgtctctcgacttacagagttccatcaaagattcatggaccagtaccgcgactaa

DBGET integrated database retrieval system