KEGG   Iodobacter sp. H11R3: EJO50_09610Help
Entry
EJO50_09610       CDS       T05767                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
iod  Iodobacter sp. H11R3
Brite
KEGG Orthology (KO) [BR:iod00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EJO50_09610 (ahpF)
Enzymes [BR:iod01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EJO50_09610 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored NAD_binding_8 Thi4 FMO-like K_oxygenase Glutaredoxin FAD_binding_3 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AZN36723
UniProt: A0A3S8ZT87
LinkDB All DBs
Position
complement(2201197..2202741)
Genome map
AA seq 514 aa AA seqDB search
MLEANIKSQLSAYLEKLQFPIELIASLDESSTAIEMSSLLQEITELSDKITLRFDDAALK
PSFGIARLGEEARVRFAGIPMGHEFTSLVLALLQVGGHPPKIEAALIEQIKALPGELHFE
TFISLTCQNCPEVVQSLNLMAVLNPKISHVMIDGALFQDEVNARQIMAVPSVYLNGEAFG
QGRMGIEEVVAKLDTGSVERQAEAISAKDPFDLLVIGGGPAGAAAAVYAARKGIRTGVVA
ERFGGQVLDTMSIENFISVQETEGPKLVMALEQHVKHYDVDIMNLQRAESLSLDENGISQ
IRLASGATLKSKSVIIATGARWREMNVPGEKEYRGRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVEHVTLLEYGSELRADAVLQKKLYSLPNVVVLKQAQTTAVLGDGQKV
RGLQYTDRQSGESHQVDLAGIFVQIGLLPNTDWLKGTLELSKHGEIEVDNRGQTSLAGVF
AAGDVTTVPFKQIVIAIGDGAKASLGAFDYLMRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagctaatatcaaatcccaactttccgcctatttagaaaaactgcaattcccg
atcgagctgattgcctctttagatgaaagcagtacggcgatagaaatgagcagcctgctg
caagagatcactgagctgtcagataaaatcacgctgcgttttgatgatgctgcgcttaag
ccttcttttggcattgcccgtttaggggaagaggcccgtgtgcgttttgccgggattccg
atggggcatgaatttacctccttggtactggctttactgcaagtgggggggcatccgccc
aagattgaagcggcgctgatcgagcaaattaaagccttgccgggtgagctgcattttgaa
acatttatttcacttacttgccagaattgcccggaagtagtgcaatcgctcaatctgatg
gcggtacttaatccaaaaatcagccatgtcatgattgacggcgcgttatttcaggatgaa
gtgaacgcccggcaaattatggccgtgccttcggtgtacctgaatggtgaagcctttggc
cagggccgcatggggattgaggaagtggttgccaagcttgataccggctcggtagagcgc
caggcggaagcgatttcagctaaagatccgttcgatttactggtgattggcggcgggccg
gctggtgcggcagcagcggtgtatgcggcgcgtaaaggtattcgcactggtgtggtggcc
gagcgttttggtggtcaggtgctggataccatgagtatcgaaaactttatttcggtgcag
gaaaccgaaggtcccaagctggtgatggcgctggagcagcatgtaaagcattacgatgta
gatattatgaatctgcaacgggctgaatcactcagcctcgatgaaaatggcatcagccag
attcgtcttgccagtggtgccactttgaaaagtaagtcggtgattattgcgaccggtgcg
cgctggcgtgaaatgaatgtgccgggagaaaaagaatatcgtggccgcggtgtggcgtac
tgcccgcactgcgatggccctttgtttaagggtaagcgcgtggccgtggtgggtggtggt
aattccggcgtagaagctgcgattgatctggccgggattgtagagcacgttaccctgctg
gagtatggttccgagctgcgcgccgatgcagtattgcagaaaaaactctatagcctgccc
aatgtggtggtgctaaagcaggcgcaaaccaccgccgtactgggtgatgggcaaaaggtc
agaggcttgcaatataccgatcgccagagtggtgaatcgcatcaggtggacttggctggg
atttttgtgcagattggtttactgcccaatacagactggctgaaaggcacgctggaatta
agcaaacatggtgaaattgaagtggataaccgtggacaaacctctttagcaggtgtgttt
gctgcaggggatgtgacgaccgtgccatttaagcaaatcgttattgcaattggtgatggg
gcaaaggcttcgcttggcgcatttgattatttaatgcgcagttaa

DBGET integrated database retrieval system