KEGG   Iodobacter sp. H11R3: EJO50_10180Help
Entry
EJO50_10180       CDS       T05767                                 

Definition
(GenBank) CHASE2 domain-containing protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
iod  Iodobacter sp. H11R3
Brite
KEGG Orthology (KO) [BR:iod00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:iod01001]
    EJO50_10180
Enzymes [BR:iod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EJO50_10180
Protein kinases [BR:iod01001]
 Serine/threonine kinases: Other
  Bacterial family
   EJO50_10180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE2 Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-ProteinID: AZN36817
UniProt: A0A3S8ZTI6
LinkDB All DBs
Position
2339392..2341914
Genome map
AA seq 840 aa AA seqDB search
MKASFWNKDGVIGAAVLLVYLTALQFTSLIFALEQRAYDVGVKLTSRNADTRIAVIAIDQ
TSIDHIGRWPWPREIHAQLIDKLADAKTKVIATSVLFTEEPKERGLVYIEKLYRLYKEDA
SAPNSVTWTTMGSVFNEAVVKLNVDQQLANSIAKAGNVILAMSFELGQAAGEPDKPLQGA
IRKWKLETSDHPANDWLTSARTDQPLKSIADGAAGVGGNSIVPDHDGVVRSIPLATRYSN
RIYPTFPLLAAATGLNLAPRQIKLTLGESITLGNVRLPVSSNASFRPYFYPAQNGKAPFS
VDSFYDVQAGKIPLDKYKDKIILIGTTAPGVAPLLITPVSPGEAPVIIAAHTLSSLLQQH
YFVSPQWNPLLSLALALLITLYLCLILPHLKAGSAAMLTGALFLLLLISHFVLMTQSMLW
IHLMGPASLLLLGYGVLTTKRYLSNEQTEEKSTAESAESNRMLGMAFQGQGQLDMAFEKL
SKVPLDDGMMGVLYNLALDFERKRQFDKAKMVYQYMAGHNPKYRDLEAKLKRAHQISETT
DSSSGGINGSMLLEDGSVEKPMLGRYQVEKELGKGAMSIVYLGKDPKVGRDVAIKTISLS
QKFEPDQIDEIRQSFLEEAENAGRLNHPNIVTILGAGEEHDLCYIAMEHLKGANLQAYTK
VDHLLPLLDCASIVGKVAQALQYAHIQHIVHRGIRPANIMYEPSEKIVKITDFGITRISD
SNKTHTAIMTGALSYMSPEQLSGKKMDGRSDLFSLGVVLYQLSTGSLPFTGESTAELIYK
IINDAPQDPRQINPLLPPMLAAIIMKALQKDETTRFQTGAHFAAAMAKLEAGLRTREANA
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctctttctggaacaaagacggagtgatcggtgcagctgtgctgctggtatat
ctgacagccctacagtttacctccttgatttttgctttagagcaacgtgcttacgatgtg
ggcgtaaagctgacttcccgaaatgcagatacccgcattgccgttattgccatcgatcaa
accagtatcgatcatattgggcgctggccctggccgcgtgaaattcatgcgcaactgatt
gataagctggctgacgcaaaaactaaagtcattgcgaccagtgtgttatttaccgaagag
cccaaagagcgcgggctggtttatatcgaaaaactataccgcctgtataaagaagacgca
tcggcccccaatagtgtgacgtggacaacgatgggctccgtctttaacgaagcagtagtt
aagcttaatgtggatcagcagctggcaaacagcatcgccaaagcaggtaatgtgatcttg
gctatgtcatttgaattgggccaagcagcaggtgagcctgataaacccctccagggcgca
atcagaaaatggaagttagaaaccagtgaccaccctgccaacgactggctcacctcggcc
aggacagaccagcctttaaagagtattgccgatggtgcagctggcgtaggcggcaacagc
atcgtacccgatcatgatggcgtagtgcgcagcattccacttgctacgcgttactccaac
cggatttacccgacttttcccctcctggctgccgctaccggcctgaatctggcccccagg
caaatcaaactaacgctgggtgaatcaattacgctgggtaatgtacgcctgcctgtcagc
agtaatgcaagcttccggccttacttttaccccgctcaaaatggtaaagcccccttttcg
gtcgattctttttacgatgtgcaggcagggaaaatccctctcgataaatacaaagacaaa
atcatcctgattggcacaacggcaccgggggtagctccattgttgatcacgccggtttcc
cccggagaggctccggttattattgcagcccacaccttatccagcctattgcaacaacac
tactttgtatcgcctcagtggaatcccctgctttcactggcactggcgcttttaatcacc
ctttatctgtgcctgatattgccacacctcaaagcaggctccgccgctatgctgaccgga
gcactgtttttgctgctgctcatcagtcattttgtgctgatgacccaatccatgctatgg
attcatttaatggggccagccagcctgttgctgctcggttatggtgtgctcacgaccaag
cgttatctgtccaatgagcaaacagaagaaaaatcgacggcagaatctgccgaatctaac
cgaatgctaggcatggcttttcaggggcagggacagctggatatggcttttgaaaagctc
tccaaagtgcctttagatgacggcatgatgggcgttttatataatctggcgctggatttt
gaaagaaagcgccaatttgataaagccaaaatggtttaccaatatatggctggccacaat
cccaaataccgcgatctggaagcaaaattaaaacgcgcacaccagatatctgaaaccaca
gacagcagcagtggcggcattaatggcagcatgctgctggaagacggtagcgtagaaaag
cccatgctgggacgttatcaggtagaaaaagagctgggcaaaggggcaatgagcattgtt
tatctaggtaaagatcccaaagttggccgcgatgtggcaattaaaacgatctcgctctcg
caaaaatttgaacctgatcagattgatgaaatacggcaatctttcttggaggaggccgaa
aacgcagggcgactcaaccaccccaacatcgtcactattttgggcgcaggagaggaacac
gatctctgctatatcgccatggagcatctcaaaggcgcaaatttacaagcctacaccaag
gtggaccatttattgccattgctagattgtgcaagtatcgtcgggaaagttgcgcaagcc
ttacagtatgcccatatacagcatatcgtccaccgcggtatcaggcccgccaacattatg
tatgagccttccgaaaaaatcgtcaaaatcaccgactttggcattacacggatcagcgat
tcaaataaaacacacactgccatcatgacgggggcactgtcctatatgtcacccgagcag
ctttcgggcaaaaaaatggatggccgctccgatttattttccctgggggtcgtgctctac
cagctcagcaccggcagtctgccctttaccggtgaatcaacggcggagcttatatacaaa
ataattaatgatgcaccgcaagacccaaggcagatcaatcctctgttaccccccatgctc
gccgccattattatgaaggctttacaaaaagacgaaacgactcgttttcagaccggcgca
cattttgctgctgctatggctaaactagaagcaggattacgtacaagagaagccaatgcc
taa

DBGET integrated database retrieval system