KEGG   Iodobacter sp. H11R3: EJO50_11045Help
Entry
EJO50_11045       CDS       T05767                                 

Definition
(GenBank) pyrimidine 5'-nucleotidase
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
iod  Iodobacter sp. H11R3
Brite
KEGG Orthology (KO) [BR:iod00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    EJO50_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AZN36973
UniProt: A0A3S8ZTZ0
LinkDB All DBs
Position
complement(2559968..2560618)
Genome map
AA seq 216 aa AA seqDB search
MKPVWIFDLDNTLHNADLHAFPVINRAMTAYLSQHLQLSEQAATDLRVDYWLRYGATMLG
LRHHHPHINPRHFLCMSHPLSELLSTVHPMPGLSVAIRRLPGDKLLFTNGPRQYAMAMLL
ALEIDDCFRSVVSVEDVDLIPKPQIAAYRRLLARFKLNPRRCILVEDTLANLKTAKRLGM
KTVWINPRSYGAEMVDLSISKLGDIARRGRWLYAGK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtctggatttttgatcttgataacacgcttcacaatgccgatttgcatgcc
tttccagtaattaaccgggcgatgacagcttatctttcccagcatttacaattgagtgaa
caggctgctacagatttacgtgtcgattactggttacgttatggagcaacgatgcttggg
cttcgccaccaccacccgcacattaatccacggcactttttgtgtatgtctcatcctttg
agcgagctgctctcgaccgttcatcctatgccgggtttatctgtggcgattcgtcgcttg
ccgggggataaattactttttaccaatggcccgcgccagtatgcgatggctatgctgctg
gcgttggaaattgatgattgtttccgcagcgtggtgagcgtagaagatgttgatctgatt
cccaagccgcagattgcggcttatcggcgcctattggcgcgctttaagctcaatccacgg
cgctgtattttggtggaagacaccctggccaatttaaaaacagccaagcggctggggatg
aaaacggtgtggattaatccgcgcagttatggggccgaaatggttgatttaagtatctct
aagctgggagatattgccaggcgtgggcggtggctctatgcgggaaaataa

DBGET integrated database retrieval system