KEGG   Iodobacter sp. H11R3: EJO50_16130Help
Entry
EJO50_16130       CDS       T05767                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
iod  Iodobacter sp. H11R3
Pathway
iod00030  Pentose phosphate pathway
iod01100  Metabolic pathways
iod01110  Biosynthesis of secondary metabolites
iod01120  Microbial metabolism in diverse environments
iod01130  Biosynthesis of antibiotics
iod01200  Carbon metabolism
iod01230  Biosynthesis of amino acids
Module
iod_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
iod_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:iod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EJO50_16130
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    EJO50_16130
Enzymes [BR:iod01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     EJO50_16130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N E1_dh DXP_synthase_N XFP_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AZN37857
UniProt: A0A3S8ZWH9
LinkDB All DBs
Position
3664499..3665296
Genome map
AA seq 265 aa AA seqDB search
MKANNIRNTILEMAFSGATVHVGCAFSIVEILTVLYRNHLNFPANDVESPVRDYMVLSKG
HGVMAQYACLHEKGYLASEDIQQYFKNGTRLKGLADAHIPGIEATTGSLGHGLSVAVGLA
LAAKLNKTEQMCYVIVGDGEINEGPIWEAALFAAQFKLDNLIVIVDKNGFQAMGTTDEVM
SLGNIEAKFLAFDFDAVTIDGHSELELDIAMSTFKANKNGKPKVLVANTVKGKGVSFMEN
DNIWHYTRLNNETYAAAVAQLQGEE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaataatattagaaatacaatattagaaatggcatttagtggtgcaacagtt
catgtgggctgtgctttttctattgttgaaattttaacggttctatatagaaatcatttg
aatttccctgcaaatgatgttgagtcaccagttagagattatatggtacttagcaagggg
catggtgtgatggcccaatatgcgtgtttgcatgaaaaaggctatttagcgagtgaagat
attcagcagtattttaaaaatggcacacggctgaaaggattggcagatgctcatatcccg
ggtatagaagcaacgactggctctttagggcacggtctttcagttgcggtgggccttgct
ctggctgctaagttaaataaaacagagcaaatgtgctatgtgattgtaggcgatggtgaa
attaatgaaggcccaatttgggaggccgctctattcgcagctcaattcaaattagataat
ctaattgtcattgttgataaaaatggtttccaagccatgggcacaacagatgaagtaatg
agccttggaaatattgaggctaaatttctagcttttgattttgatgcagtaacgattgat
ggtcactcagaattagaattggatatcgcaatgagtacttttaaagcaaataaaaatggc
aagcccaaagtgctcgtggcaaatacagtaaaaggtaagggcgtttcctttatggaaaac
gataatatctggcactacactcgtttgaataatgaaacctatgctgctgcagtggcccaa
ttgcagggagaagaataa

DBGET integrated database retrieval system