KEGG   Isosphaera pallida: Isop_2183Help
Entry
Isop_2183         CDS       T01407                                 

Definition
(GenBank) Hydroxypyruvate isomerase
  KO
K01816  hydroxypyruvate isomerase [EC:5.3.1.22]
Organism
ipa  Isosphaera pallida
Pathway
ipa00630  Glyoxylate and dicarboxylate metabolism
ipa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Isop_2183
Enzymes [BR:ipa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.22  hydroxypyruvate isomerase
     Isop_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADV62761
UniProt: E8R504
LinkDB All DBs
Position
complement(3177906..3178916)
Genome map
AA seq 336 aa AA seqDB search
MEQPAAVSRGRLRSVLATFGTTLPMSAADSFRMTPSKFVATRRSAIAAAGAAGLAWMSGL
GRATTCTRSDVKPHEPTWLTYAVNAEMFWSNLPFEERLKRIAEAGFAHYEFWPWRNKNLD
RVAELNRELGLKPVQFTAFWGITHPNRRDLFLNDLAEAIGVAQTLGLDLLTVVAGEESPG
LSRDEQTRAVVETLRAGAELVAPAGITLILEPLNVLVDHPKQLVVTSQQAAQVIDAVGSP
HVKILFDVYHQQISEGNLSGNIRAHKERIGYYQIADHPGRNEPFTGEIHYPHILKVIHET
GQTRPIGLELRPRRDPLQALAAVRRADAEARVLAQA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacctgccgcggtttcgcgcggtcgtctccgctctgtccttgccacctttggg
acgacgttaccgatgagcgccgctgattctttccggatgactccctcgaagttcgtcgcc
acgcgccgttcggcgatcgccgccgcaggcgcggcgggtctggcctggatgagcggcttg
ggacgcgcgaccacctgcacacgcagcgacgtgaagccccacgagccgacttggctgacc
tatgcggtcaacgctgaaatgttctggtccaaccttcccttcgaggaacggctcaagcga
attgccgaggccggctttgcccactacgagttttggccctggcgaaacaaaaacctcgac
cgggtcgcggaactcaaccgcgagttgggcctaaaaccggttcaattcaccgccttttgg
ggaatcacccaccccaaccgccgggacctcttcctcaacgaccttgccgaagccatcggc
gtggcccaaaccttgggtttggatctgctgacggtggtggcaggcgaggaaagcccggga
ttgtcccgtgacgagcaaacccgtgctgtggtcgaaaccctccgcgctggggcggaactg
gtcgcccccgccggaatcaccttgatcctggaaccgctcaacgtgttggtcgatcacccc
aaacaactggtggtgacttcccaacaagccgcccaagtgatcgacgccgtcgggtcgccg
cacgtcaaaatcctcttcgacgtttatcaccagcaaatcagcgaaggcaacctcagcggc
aacatccgcgcccacaaggagcggattggctactaccagatcgccgaccaccccggacgc
aacgaaccattcaccggcgagatccactatcctcacattctcaaggttattcacgagacc
ggtcaaactcggccgatcggcctggaactgcgcccccgacgcgacccactccaagcgttg
gccgctgtccggcgtgccgacgccgaagcccgcgttttggctcaagcctga

DBGET integrated database retrieval system