KEGG   Isosphaera pallida: Isop_3171Help
Entry
Isop_3171         CDS       T01407                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ipa  Isosphaera pallida
Pathway
ipa00473  D-Alanine metabolism
ipa00550  Peptidoglycan biosynthesis
ipa01100  Metabolic pathways
ipa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ipa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Isop_3171
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Isop_3171
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Isop_3171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ipa01011]
    Isop_3171
Enzymes [BR:ipa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Isop_3171
Peptidoglycan biosynthesis and degradation proteins [BR:ipa01011]
 Precursor biosynthesis
  Amino acid ligase
   Isop_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADV63735
UniProt: E8R405
LinkDB All DBs
Position
4621896..4622942
Genome map
AA seq 348 aa AA seqDB search
MMAESARAEAGGRLALVVGSNRATRAEARALGWTLTTLGWSVAPILLGSPVSQRVLAGRI
AATRADVALIRDDQATRLELATWRRLEAVGIPIVGGGAALAALGASAGLAGRARLLTMLR
AAGLPTPSWLRPSPRAELVFDLDTSASSATAWLVRRASSEDPLADAGDPEPCRNLERAYE
MVARWGGDWLIEEFIEGREFQIAWSPEASSERLWTVGELVHHQLQAHPDAWSQPGPWALR
TQRARRFPGALEDRSSRWICPAVVEDDQARMLKRLTEAAARAVGCVDPALVTIRWDRSGH
PRVVGVDLRPDLGPGSVWARLVRASGLSYRAALSRLLNRRRGANRHAA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggagtcggcacgcgccgaggccggggggcgtttagcgttggtggtcggttca
aaccgcgccacgcgggccgaagcgcgggcgctgggctggactctgaccacgttgggctgg
agtgtcgctccgatccttctgggttcgccagtgagtcaacgggtgctggccgggcggatc
gccgcgacccgggccgatgtggcgctgatccgcgacgaccaggccacgcggttggaactg
gcgacctggcggcgtttggaggcagtggggattccaattgtgggcggcggggcggccctg
gccgctttgggagcctcggcgggtttggcgggccgagcccgcttgcttacgatgctgagg
gccgcgggattgcccacgccgagttggttgcgacccagtccgcgcgccgaactggtcttc
gacttggacacaagcgcgtcgtcggcgaccgcctggttagttcgtcgagcttcctccgag
gaccccctcgccgacgcgggcgatcccgaaccctgtcgtaacttggagcgggcctatgag
atggtcgcgcgctggggtggcgactggttgatcgaggagttcatcgagggacgggagttt
caaatcgcctggtcgccagaggcgagttccgagcggctttggaccgttggcgaactggtt
catcaccaactccaagctcaccccgacgcttggtcgcaacctggtccctgggcgctgcgg
actcaacgggcacgtcggttcccgggagcgttggaggatcgctcgtcccgttggatttgc
cctgcagtggtagaggatgaccaggcgcggatgctgaaacgcttgaccgaggcggccgcg
cgggcggtggggtgcgtcgatcccgcgttggtgaccatccgttgggatcgttctggtcac
ccccgcgtggtcggagtcgacctccggcccgatctgggccccgggagcgtttgggctcgg
ttggtccgcgcgtccggcctgagttatcgagccgccttgagtcgcctgctaaaccgacgg
cgcggggccaaccgtcacgccgcctag

DBGET integrated database retrieval system