KEGG   Isosphaera pallida: Isop_3359Help
Entry
Isop_3359         CDS       T01407                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
ipa  Isosphaera pallida
Brite
KEGG Orthology (KO) [BR:ipa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipa01001]
    Isop_3359
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Isop_3359
Protein kinases [BR:ipa01001]
 Serine/threonine kinases: Other
  Bacterial family
   Isop_3359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like Fructosamin_kin PIP49_C RIO1
Motif
Other DBs
NCBI-ProteinID: ADV63921
UniProt: E8R619
LinkDB All DBs
Position
complement(4921237..4922895)
Genome map
AA seq 552 aa AA seqDB search
MTPRPQDSANTSVSASAKSSPQDREASLGSMSAVEDFASLGGGGTISGDRPVLGDYEVLE
LLGKGGMSLVARGRHRPTGLIVALKILPKELARKPTTLQRFLNEARLLASLSHPNVVELL
DVGHAQDRHFLVFEYVNGGDLSRYVKKHGSMPVARVIEVAIQTAEALDHAAQAGLVHRDI
KPGNLLITSEGQVKLADLGLARTILDDERLTREGTTIGTIDYMAPEQARDSHAATIRSDI
YSLGCTLYYLLTGSPPYVADKISEKVLLHIRGDIPDVRKVRPDVPPEFAAILKTMMAKSP
ERRYDSYRQLIQALRSLSATRPTAEFPVAPKPPSRSAPPEMPSDSESEFDLGASSVGTVV
ELVPGSRSADNAAAFASPNQPFSFGDDPGFEDELPAVTPLASSSLAGSSSRSGSSSAPAA
TDLNHTQPSPRSSRASTEAASSKSSRSTRSAKRNRSIHKVRPKDLSAETDDFHPLSPAPL
PSPPSYGMFGYHPSEARSRDDNELRVMVMVMGGVLLALVVGFLTISILNSRRWSSEVPPP
PPSLNRVDFTPR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgcgaccccaagactccgcgaacacctcggtttcggcgtcggccaaatcgagt
ccgcaggaccgcgaggcgtcgcttggttcgatgtcggcggtcgaagattttgcttcgcta
ggcggcggggggacgatttcaggcgatcgccccgtccttggcgactacgaggtgctggaa
ctgctcggcaaaggcgggatgagcttggtcgcgcggggccgacatcgtcccactggactg
atcgtcgcgctcaaaattttgcccaaggaactcgctcgcaagcccaccacccttcaacgc
tttctcaacgaggctagactcctggcctcgttgagccatcccaacgtggtggaactgctc
gacgtgggccacgcgcaggatcgtcacttcctggtcttcgaatacgtcaacggcggtgat
ctttcgcggtacgtcaaaaaacatggttccatgccggttgctcgtgtgatcgaagtggcg
atccagaccgccgaggcgcttgatcacgccgcccaggctgggttagtccaccgcgacatc
aaacccggcaacctcctgatcaccagcgaaggccaggtcaagctcgccgatctgggactg
gcgcggaccatcttggatgacgaacggttaactcgcgaaggtaccacgatcggcaccatt
gactacatggcccccgagcaggcccgcgacagccacgccgccaccattcgcagcgatatt
tactccctgggttgcaccctctactacctgttgaccggctccccgccttatgtcgccgac
aagatctccgaaaaagtactccttcacattcgcggcgacattcctgacgttcgaaaggtt
cgacccgatgtcccgccggagttcgccgcgatccttaagactatgatggccaagtcgccc
gagcggcgttacgactcctatcggcaactcattcaggcgttgcggtccctctcggccacg
cgtccgacggcggagttcccggttgcccctaagcccccttcgcggtctgcccctcccgaa
atgccgtccgattccgagtccgagttcgatctgggcgcgtcctcggtgggaacagtagtg
gagttggttccagggagtcgatcggcagacaacgctgcagcgtttgcctcaccaaaccaa
cctttcagtttcggtgacgatccagggtttgaagacgagcttcccgccgtaacgcctctc
gcctcatcatcgcttgccggctcatcctctcggagtgggtcgtcgtccgcgccggctgca
accgacctcaaccacacccaacccagtccacgatcaagtcgggcgtccaccgaagctgcc
tcgtcgaaatcgtcgagatcaacccggtccgcgaaacggaaccggtctatccacaaggtc
cgtcccaaagaccttagtgcggaaacggacgatttccatccgctctcccctgccccgctc
ccctccccaccgagctatgggatgttcggataccatccgagcgaagctcgatcccgcgac
gacaatgagctgcgggtcatggtgatggtcatgggcggggtcctcctggcgctggtggta
gggtttctcaccatttcgattttgaattcacgaagatggtcctccgaagttccgccgccc
ccgccatcactcaaccgggtggatttcactcctcgatga

DBGET integrated database retrieval system