KEGG   Idiomarina piscisalsi: CEW91_01845Help
Entry
CEW91_01845       CDS       T04931                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ipi  Idiomarina piscisalsi
Pathway
ipi00250  Alanine, aspartate and glutamate metabolism
ipi00410  beta-Alanine metabolism
ipi00430  Taurine and hypotaurine metabolism
ipi00650  Butanoate metabolism
ipi01100  Metabolic pathways
ipi01110  Biosynthesis of secondary metabolites
ipi01120  Microbial metabolism in diverse environments
ipi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CEW91_01845
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CEW91_01845
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEW91_01845
   00430 Taurine and hypotaurine metabolism
    CEW91_01845
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CEW91_01845
Enzymes [BR:ipi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CEW91_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HTH_8 DNA_topoisoIV
Motif
Other DBs
NCBI-ProteinID: ASG64972
UniProt: A0A241R1C9
LinkDB All DBs
Position
388276..389925
Genome map
AA seq 549 aa AA seqDB search
MSSKTEVAEVSEESLYRIFTIPEAPDSTLSKIEKHLSENLMGFLGDHIVAREKPLQEIER
DFDRSQIPEEPQFVSDHTEFLLDKLVAHSVHTASPRFIGHMTSALPYFLLPLAKLMVGLN
QNLVKIETSKAFTPLERNVIGMLHHLVYREEATFYNRWMHSAQHSLGAFCSGGTIANMTA
LWVARNRLLQADGNFGGIAADGIAAGLQHYGYSRLTVVVSERGHYSLSKAADVLGIGRRN
LVAVPTDSNNRIRIDKLRETCEAISAEGGKVLALVGVAGTTETGHIDPLDEMADVAEDIG
AHFHIDAAWGGATLLSEQHRSLLHGVERADSITIDAHKQMYVPMGAGLVLFKNPSLVKSI
EHHAEYIIRQGSKDLGSHTMEGSRAGMAMMVFSAMHVIGRRGYELLINNSIDKARYFSKL
ISEQDDFEVITEPELCILTYRFVPERVKKALENATSEQLARLTPHLNALTRYIQKRQRET
GRSFVSRTKLTPAQYHHEPTVVFRVVLANPLTTHDMLEEVLEEQREIASKATSLRGALHT
EMRELGMLN
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
ttgagctctaaaaccgaagtggctgaggttagtgaagaatcgctttatcgcattttcacc
attccggaagcgcccgactcgacattgagtaaaatcgaaaagcatttatctgagaacctc
atggggtttttgggtgatcatatcgttgcgcgcgagaagcctctgcaggaaattgagcga
gactttgaccggtcacaaatccccgaagagccgcaattcgtttctgaccatacggagttt
ttgctcgataaattagtggctcactcagtacataccgcttcgccgcgttttattgggcac
atgacatcagcgttaccctattttttattgccgctggcgaagctgatggtcggcttgaac
cagaacctggtgaaaatagaaacttcaaaagcatttacgccattggagcgtaacgtcatt
ggcatgctgcaccatctggtttaccgcgaagaggcgacgttttataaccgttggatgcac
agtgcccaacactcattgggcgccttctgctcaggcgggactatcgccaatatgacggcg
ttatgggtagcacgaaaccgactattacaagctgatggtaatttcgggggcattgctgcg
gacggtattgctgctggcttgcaacattatggctactcacgattgacggtggtggtttcg
gagcgcgggcactactcgttgagcaaagccgccgatgttctgggtattggtcggcgtaat
ttagtggcagtgcccacagacagcaacaaccgcattcgtatcgataagctgcgtgaaacc
tgtgaagcaatatctgcagagggcggcaaagtactggcactggttggtgtggcgggtacc
acagagaccggacacattgacccgctagacgagatggccgatgtcgccgaagatattggc
gcgcattttcatattgatgctgcatggggtggcgcaaccctgttatcagagcagcaccgg
tcactattgcatggtgttgagcgtgccgacagcattaccattgatgcccacaagcaaatg
tacgtgccgatgggggccggtctggtattgtttaagaacccgtcattggtgaagtcgata
gaacatcatgccgagtatattattcgacaaggctctaaagacctcggctcgcataccatg
gagggctcccgggcgggcatggccatgatggtgttttccgctatgcacgtgatagggcgc
cggggttatgagctgctaattaacaacagtattgataaagcgcgttacttttcgaaactt
attagtgagcaagatgacttcgaggtcattaccgagccggagctttgcatactgacctat
cgctttgtaccggaaagagttaaaaaggcgcttgaaaacgcaacgtctgagcagttggcg
cgtttaaccccgcacttaaatgcgttaacgcgttatattcaaaaacgtcagcgtgaaacc
gggcgctcatttgtatcgcggaccaaattgacaccagcacagtatcatcatgaacccact
gtggtgtttcgtgttgtgttggcgaacccgctaacaacgcacgacatgctggaagaagta
ctggaagagcagcgcgaaatcgcttccaaagccaccagtctgcgaggcgctttgcatacc
gagatgcgtgaactcggtatgctgaattaa

DBGET integrated database retrieval system