KEGG   Idiomarina piscisalsi: CEW91_10475Help
Entry
CEW91_10475       CDS       T04931                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ipi  Idiomarina piscisalsi
Pathway
ipi00473  D-Alanine metabolism
ipi00550  Peptidoglycan biosynthesis
ipi01100  Metabolic pathways
ipi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ipi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CEW91_10475
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEW91_10475
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CEW91_10475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ipi01011]
    CEW91_10475
Enzymes [BR:ipi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CEW91_10475
Peptidoglycan biosynthesis and degradation proteins [BR:ipi01011]
 Precursor biosynthesis
  Amino acid ligase
   CEW91_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A DUF1327
Motif
Other DBs
NCBI-ProteinID: ASG66536
UniProt: A0A241R5Q5
LinkDB All DBs
Position
complement(2202821..2203750)
Genome map
AA seq 309 aa AA seqDB search
MTPEAFGKVAVMLGGYSAEREVSLKSGMAVLKALVARGIDAHAFDPAAHDLHELIDEGYE
RVFIALHGRGGEDGSMQGALDVLEMPYTGSGVLGCALAMDKVRCKQIWHALELPTAPWRV
VRAAELDSVNSEELIAELGGRVIVKPAREGSSIGMSIADTGQHLESALKHAVQFDEHVLV
EKWIEGKEYTVALLDNNALPVIRLETPHEFYDFEAKYQANDTLYHCPSGLNEQDETYLKT
LAEEAFKAIDAKGWGRIDVMRAKEGNWYLLEANTVPGMTEKSLVPMAAKASGIDFGELVQ
RILAQTLEQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgaagcttttggaaaagttgcggtcatgcttggcggctactcggccgagcgg
gaagtgtcattaaagtcaggcatggcggtgttaaaagcgttagtggcgagaggcattgat
gcgcatgcgtttgacccggccgcacatgacctgcatgaactgatcgatgagggttacgag
cgggtattcattgcgttgcatggtcggggcggtgaagacggcagtatgcaaggcgctttg
gatgtattggaaatgccttacaccggcagtggcgttttaggttgcgctttagccatggat
aaagtgcgttgtaagcaaatctggcacgcacttgaattgccgacagcgccgtggcgtgtg
gttagagcggcggagcttgatagcgttaatagcgaggaattaatagccgagcttggtggg
cgtgtcattgtgaagccggcgcgagagggctcctctataggcatgagcatagcggacacc
ggtcaacatttagagtcagcattaaaacacgcggtccagtttgatgagcacgttttagtt
gaaaaatggatagaaggtaaggaatacaccgtcgctttgttggataataacgcgctgccg
gttattcgcttggaaacaccacatgagttttacgactttgaagccaagtatcaggcaaac
gataccttgtatcactgtccgtctggcttaaacgagcaggatgaaacgtacttgaaaact
ctggccgaggaagcgtttaaagcgatagatgcgaaaggttggggacgtatcgatgtgatg
cgtgcaaaagagggtaactggtacttgttagaagcgaatactgtgcccggtatgacagaa
aaaagcttggtgcctatggcagcaaaagcatcgggtattgattttggtgagctggtgcag
cgcatattggcgcagacactggagcagtag

DBGET integrated database retrieval system