KEGG   Ilyobacter polytropus: Ilyop_0106Help
Entry
Ilyop_0106        CDS       T01337                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00010  Glycolysis / Gluconeogenesis
ipo00020  Citrate cycle (TCA cycle)
ipo00620  Pyruvate metabolism
ipo00640  Propanoate metabolism
ipo00650  Butanoate metabolism
ipo00680  Methane metabolism
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01120  Microbial metabolism in diverse environments
ipo01130  Biosynthesis of antibiotics
ipo01200  Carbon metabolism
Module
ipo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ipo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_0106
   00020 Citrate cycle (TCA cycle)
    Ilyop_0106
   00620 Pyruvate metabolism
    Ilyop_0106
   00640 Propanoate metabolism
    Ilyop_0106
   00650 Butanoate metabolism
    Ilyop_0106
  09102 Energy metabolism
   00680 Methane metabolism
    Ilyop_0106
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ilyop_0106
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ilyop_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ADO81895
UniProt: E3H6L0
LinkDB All DBs
Position
107813..108991
Genome map
AA seq 392 aa AA seqDB search
MAIKERMSGNESIAIAMRQINPDVLPAFPITPSTEIPQYFSKYVADGLVQTEFIPVESEH
SAMSAAIGAQAAGARTTSATSSAGLALMWEMLHVAASCKLPITLACVNRALTGPININAD
HSDSMGARDTGWIQIYSETNQEAYDNYIQAVRIAEHKDVMLPAMVCQDGFITSHAVENIE
LLEDKEVRDFVGEYAPEDSLLNPGYPISHGPYDTATFYMEHKRLQAESMKKAKKVILSVA
EEFKKVSGREYGLFEEYRMEDAEYAMVIINSSAGTAKVAVDELRKEGKKVGLIKIRVFRP
FPMEELAEALKHLKAIAVMDKSEGFSSAGGPIFAEVRSAMYDLSEKPSVVNYIYGLGGRD
FTVDSAKQVYDEIEDIKGTSIDDIYRYLGVRG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaaagaaagaatgtcaggaaacgaatcaatagctatagcaatgaggcagata
aatcctgatgtattacctgcctttccaataactccgtctacagaaattccacagtatttt
tcaaagtatgtggcagatggattggtgcaaacagaatttataccggtagaatcagaacac
agtgctatgtcagcagcgataggagctcaggcagcaggagcaagaactacatcagcaact
tcatcagccggtcttgcccttatgtgggagatgctccatgtggctgcttcctgtaaatta
ccaataacacttgcatgcgtaaacagagctcttaccgggccaattaatataaatgcagat
cacagtgactctatgggagctagagacacagggtggattcaaatatatagcgaaacaaat
caagaagcttatgataactatattcaagcagtaagaattgcagagcacaaagatgttatg
ttgcctgcaatggtgtgccaggacggatttataacaagtcatgctgttgaaaacatagaa
cttctagaagataaagaagtaagggattttgtaggagaatacgctccagaagatagtctc
ttaaatccagggtatcctatttctcatggtccttatgatacggcaactttttatatggaa
cataaaagacttcaggcagagtctatgaaaaaagctaagaaagttattctttcagtggct
gaagaatttaaaaaagtttcaggaagagagtacggactttttgaagaatacagaatggaa
gatgcagaatatgcaatggttataatcaactcatctgctggaactgcaaaggtagcagtg
gatgagcttagaaaagagggtaaaaaagtaggacttatcaagataagggtattcagacca
ttcccgatggaggaactggcagaggctctgaagcatcttaaggctattgccgttatggat
aaaagtgaagggttttcttcagcggggggacctatttttgctgaagtaagatcggcaatg
tatgatctatctgaaaagccaagtgttgtaaactacatctatggtctaggtggaagagat
ttcactgttgattcggcgaaacaggtgtatgatgaaatcgaagacataaaaggaacatct
atagatgacatatacagataccttggtgtaagaggatag

DBGET integrated database retrieval system