KEGG   Ilyobacter polytropus: Ilyop_1297Help
Entry
Ilyop_1297        CDS       T01337                                 

Definition
(GenBank) 1,3-propanediol dehydrogenase
  KO
K00086  1,3-propanediol dehydrogenase [EC:1.1.1.202]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00561  Glycerolipid metabolism
ipo00640  Propanoate metabolism
ipo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Ilyop_1297
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Ilyop_1297
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.202  1,3-propanediol dehydrogenase
     Ilyop_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Lamprin
Motif
Other DBs
NCBI-ProteinID: ADO83078
UniProt: E3H9G9
LinkDB All DBs
Position
1417966..1419123
Genome map
AA seq 385 aa AA seqDB search
MRYYDYLMPSVNFFGPGCLEVIGERAKILNGTKALIVTDKFLSSLKGGAVEKTLEYLKSA
GVEAVVFDNVEPNPKDTNVYEGAKVYKENNCDMIITVGGGSPHDCGKGIGIAATHDGDIC
DYAGIETLTNALPPIIAVNTTAGTASEVTRHAVITNTKTKVKFVIVSWRNLPQVSINDPL
LMIGKPAGLTAATGMDALTHAVEAYISKDANPITDAAAIQAIKLIAQNLRLAVANGENLK
ARENMAYASVLAGMAFNNGNLGYVHAMAHQLGGLYDMPHGIANAMLLPHVCKYNMISNLD
KFADIAEFMGENVDGLSKSEAAEKAISAMFRLSSDLGIPTSLEEAGIKESDIELMAENAL
KDGNAFSNPRKGNEKDVENIFKAAM
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagatattatgattatttgatgccaagtgttaactttttcggacctggatgccttgag
gttataggtgagagagctaaaattttaaacggaacaaaagctttaatagtcactgacaag
ttcttaagttcactaaaaggtggagctgtagaaaaaactttggaatatctaaaatccgct
ggagtagaagcagttgtttttgacaatgtcgagccaaatcctaaagatacaaacgtatat
gaaggtgcaaaagtttataaagagaataattgtgacatgatcatcactgttggtggagga
tctccccatgattgtggtaaaggtattggtattgcagctactcacgatggagatatctgc
gactatgcaggcatagagacacttactaatgctctgcctccaattattgcggtaaatact
actgctggtacagcttctgaagttacaagacatgctgttatcaccaatactaaaacaaag
gttaagtttgtaatcgtaagctggagaaatcttcctcaggtttcaataaatgatccactt
ctaatgattggaaaacctgcgggacttacagctgctactggaatggatgcactgactcat
gctgtagaggcctacatatcaaaagatgcaaatcctataactgatgctgcagcaatacag
gctatcaaacttattgctcaaaatctgagacttgccgttgcaaacggagaaaacttaaaa
gccagagaaaacatggcctacgcttctgttcttgctggaatggcttttaacaacggaaac
ctaggttatgtacacgctatggctcaccaattaggagggctttacgatatgccccacggt
atagcaaatgcaatgcttttaccacatgtgtgtaagtacaacatgatctctaatctggat
aaatttgctgatattgctgaattcatgggagaaaatgtagacggactttctaaatcagaa
gctgctgaaaaggcaatcagtgcaatgttcagactttcatcagaccttggaattccaaca
agtttagaagaagcaggaatcaaagagtctgatatagaattgatggctgaaaacgctctt
aaagatggaaatgcatttagcaaccctagaaaaggtaatgaaaaggacgttgaaaatatt
tttaaagctgcaatgtag

DBGET integrated database retrieval system