KEGG   Ictalurus punctatus (channel catfish): 100304658
Entry
100304658         CDS       T04658                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04068  FoxO signaling pathway
ipu04217  Necroptosis
ipu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100304658 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100304658 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100304658 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    100304658 (stat3)
Transcription factors [BR:ipu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100304658 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 100304658
NCBI-ProteinID: XP_017348746
UniProt: W5UMT5
LinkDB
Position
2
AA seq 788 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAQQDGQAAQHSGTVVTEKQQLLEHRLQDIRKKVQDMEQKMKMLENLQDDFDFNYKTLKS
AGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVADMAGLLQAMDFVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPIV
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLFPDIPKEEAFGKYCRPEAQPDAENGDFTGCITQPYLKTKFICVTPC
PSIFMDLPDSELLANGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGPLESLTLDMDM
NTDVASPM
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagttggagacgcgctacctggagcagctgtaccat
ctgtacagtgacagcttccctatggagctccgccagtttcttgccccctggatcgagagt
caggactgggcgtatgcagccaataaggagtctcacgccacgctggtgtttcataacctg
ttgggagagatcgaccagcagtacagccgcttcctgcaggagaacaacgtcctttaccag
cacaacctgagacgcatcaagcagcacctgcagagcaagtacctggagaagcccatggag
atcgctcgcatcgtcgcacgctgtctgtgggaggagcagagactgctgcagaccgccact
actgctcagcaagatggccaggccgctcagcacagcgggacagtggtgacggagaaacag
cagctcctggagcacagactgcaggacatcaggaagaaagtgcaggatatggagcagaaa
atgaagatgctggagaacctgcaggatgactttgatttcaactacaagactctgaagagc
gcaggcgagctgtcccaggacctgaatgggaacagccaggctgcagccaccagacagaag
atggcccagctggagcagatgctgagcgccctggatcagctcaggaggcaaatcgtggct
gatatggcagggctgctgcaggccatggactttgtgcagaagaatctgactgatgaggag
cttgctgattggaagaggagacagcagatcgcctgcatcggaggacctcccaacatttgc
ctggaccggctagagacatggatcacgtcattggccgagtctcagctacagatcaggcag
cagataaagaaactggaggagctccagcagaaagtctcgtataaaggagatcccatagtt
cagcaccgccctgccctggaggaaaagatcgtagacctcttccgcaatctcatgaagagt
gcgtttgtggttgagagacagccgtgtatgccaatgcatcccgacagacctctggttata
aagacaggagttcaattcaccaataaagttcggttactggtgaaattcccagaactaaat
taccagctgaaaatcaaagtttgcatcgacaaggagtctggagatgttgcagccattcga
gggtcacgcaagttcaacatcctgggcacgaacaccaaggtgatgaacatggaggagtcc
aacaatggcagcctgtccgctgaattcaaacacctgactctgcgagaacagaggtgtggc
aacggtggccgaaccaacagcgacgcctctctgatagtcaccgaagagcttcatctgatc
acctttgagacagaggtttaccaccagggccttaaaatcgacctcgagacacactctctc
cctgttgtagtcatttctaatatctgccagatgcccaacgcctgggcatccattctgtgg
tacaacatgctgactaaccatcccaagaatgtgaatttcttcacgaagcctccagtgggt
acatgggatcaggtggctgaagttctgagctggcagttttcctccacaaccaagagaggc
ctgactattgagcaactcaccacactggctgagaaactgcttgggccttgtgtgaactac
tccggttgccagatcacttgggccaagttttgcaaagagaacatggcaggaaaagggttc
tcattctgggtttggttggataacatcattgacttggtgaagaagtacatcctagctctg
tggaatgagggatatatcatgggcttcatcagtaaggagagggagagggccatcttgagc
ccaaagccacctgggacatttctgctgcgtttcagtgagagcagtaaggagggaggcatc
acattcacctgggtggaaaaagacatcagtggtaagacacagatccagtcagttgagccg
tacactaagcagcagctgaacagcatgtccttcgccgaaatcatcatgggctacaagatc
atggacgccacaaacatcctggtgtctccactcgtctaccttttccccgacatccctaaa
gaggaggccttcgggaagtactgccggccagaagcccagcctgatgcggaaaacggggat
ttcaccggatgtatcactcagccgtacctgaagactaagttcatctgcgtcaccccgtgt
ccttccatcttcatggaccttccggacagcgaactgctggctaacggcttccctgggact
aactcgggtaacacgagcgacctgttccccatgtctcctcgcactctcgactctctgatg
cacaatgaggctgaggccaaccctggacctctcgaatccctcactctggacatggacatg
aacacggatgtggcctcgcccatgtga

DBGET integrated database retrieval system