KEGG   Ictalurus punctatus (channel catfish): 100304853Help
Entry
100304853         CDS       T04658                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00010  Glycolysis / Gluconeogenesis
ipu00053  Ascorbate and aldarate metabolism
ipu00071  Fatty acid degradation
ipu00280  Valine, leucine and isoleucine degradation
ipu00310  Lysine degradation
ipu00330  Arginine and proline metabolism
ipu00340  Histidine metabolism
ipu00380  Tryptophan metabolism
ipu00410  beta-Alanine metabolism
ipu00561  Glycerolipid metabolism
ipu00620  Pyruvate metabolism
ipu01100  Metabolic pathways
Module
ipu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100304853 (aldh2)
   00053 Ascorbate and aldarate metabolism
    100304853 (aldh2)
   00620 Pyruvate metabolism
    100304853 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100304853 (aldh2)
   00561 Glycerolipid metabolism
    100304853 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100304853 (aldh2)
   00310 Lysine degradation
    100304853 (aldh2)
   00330 Arginine and proline metabolism
    100304853 (aldh2)
   00340 Histidine metabolism
    100304853 (aldh2)
   00380 Tryptophan metabolism
    100304853 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100304853 (aldh2)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100304853 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100304853
NCBI-ProteinID: XP_017307563
UniProt: A0A2D0PLT6
LinkDB All DBs
Position
22
AA seq 518 aa AA seqDB search
MLRTGLTRVVPHISRISACRFSAAAIPAPNPQPEVHYNKLFINNEWHDAVSKKTFPTLNP
ATGEVICQVAEGDKADVDKAVKAAKDAFRLGSPWRHMDASQRGLLLYRLADCIERDSAYL
AELETLDNGKPYAVAYTVDLPMVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNIIS
GMGPTAGAAISSHVDVDKIAFTGSTEVGHLIQQASGTSNLKKVTLELGGKSPNIILSDAD
MAQAVDQAHMAIFFNQGQCCCAGSRTYVQENIYNEFVERSVEKTKKRIVGNPFNLQTEHG
PQIDDEQFQKILGYINSGKREGAKLMCGGGVGADRGYFIQPTIFGDVQDGMKIAREEIFG
PVMQILKFKTIEEVIERANDTKYGLAAAVFTKDINKAQYISNSLRAGTVWINCYNVFGVQ
APFGGYKASGTGREMGEYGLENYTEVKTVTIKIPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcaccggcctcacacgagtcgtcccgcacatctcccgcatttccgcgtgcagg
ttttccgctgcagcaattcctgcaccgaaccctcagcccgaggttcactacaacaagctc
ttcattaacaacgagtggcatgatgctgtgagcaagaaaacctttccaaccctcaatcct
gccactggtgaagtcatctgccaggttgcagaaggtgataaggcagatgtagataaagct
gtgaaggctgcaaaggacgcattcagacttggttctccatggcggcacatggacgcatct
cagcgtggactccttctttatcgcctggctgattgcatcgagagggactctgcctacttg
gcagagctggaaactttggacaatggaaagccatatgctgtggcctacacagttgatttg
cccatggtggtcaaatgtttaaggtattatgcaggctgggctgataaatgggagggcaag
accattccaattgatggtgattatttctgctatacccgacatgagcctattggagtgtgt
ggccagatcattccttggaatttccctctgctgatgcaggcatggaaactgggacctgct
ctggctacaggtaacaccgtagtgatgaaggtggcagagcagacacctctcactgcactc
tacgtggccagcctgatcaaagaggtgggtttccctccaggtgttgtgaacatcatctct
ggaatgggccctacagctggggctgccatctcttctcacgttgatgtggataagattgcc
ttcactggctccactgaggtaggtcacctaattcagcaagcctctggcaccagcaaccta
aagaaagtaactctggaactgggaggaaagagtcccaacattattttatctgatgccgac
atggcgcaagcagtggaccaggctcacatggccatcttcttcaaccagggtcagtgctgc
tgtgcaggttctcgcacctatgtgcaggaaaacatctacaatgaatttgtcgagcgcagt
gtggaaaaaacaaaaaagagaattgtgggaaatccatttaaccttcaaactgagcacgga
ccgcagattgatgatgagcagttccagaagattctgggctacataaacagtgggaaacgt
gaaggagcaaagctcatgtgtggaggcggtgttggagcagaccgcggttactttatccag
cctactatctttggagatgttcaggatggcatgaaaattgctcgtgaagagatcttcggt
ccagttatgcaaattctgaagtttaagaccatagaagaggtgattgagagagccaatgac
accaagtatggcctcgcagctgctgtcttcacgaaagatatcaacaaggcgcagtacatc
tctaacagtcttcgtgctggcactgtctggattaactgctacaatgtgtttggagttcag
gctccattcggtggttacaaggcctcagggactgggcgtgaaatgggagagtatggcctg
gaaaactacactgaagtcaaaactgtaacaattaaaattcctcagaagaattcgtaa

DBGET integrated database retrieval system