KEGG   Ictalurus punctatus (channel catfish): 100304860Help
Entry
100304860         CDS       T04658                                 

Gene name
pfkp
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00010  Glycolysis / Gluconeogenesis
ipu00030  Pentose phosphate pathway
ipu00051  Fructose and mannose metabolism
ipu00052  Galactose metabolism
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
ipu01230  Biosynthesis of amino acids
ipu03018  RNA degradation
Module
ipu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100304860 (pfkp)
   00030 Pentose phosphate pathway
    100304860 (pfkp)
   00051 Fructose and mannose metabolism
    100304860 (pfkp)
   00052 Galactose metabolism
    100304860 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100304860 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ipu01009]
    100304860 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ipu03019]
    100304860 (pfkp)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100304860 (pfkp)
Protein phosphatases and associated proteins [BR:ipu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100304860 (pfkp)
Messenger RNA biogenesis [BR:ipu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100304860 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100304860
NCBI-ProteinID: XP_017336200
UniProt: A0A2D0S1X5
LinkDB All DBs
Position
1
AA seq 789 aa AA seqDB search
MSKPDTKKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGM
VDGGDNIKEAKWESVSSMLQVGGTVIGSARCKEFRTREGRLKAAHNLVQHGITNLCVIGG
DGSLTGANLFREEWSDLLAELVQQGLIDDEAVQKYSALHIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDG
WEETMCEKLSANRAGRKRLNIIIVAEGAIDRSNKPITTDRVKDLVVRCLGFDTRVTILGH
VQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQAVRLPLMECVQMTQEV
QKAMDEKKFEDAVKLRGRSFENNLKTYKLLAHRKPESELPCSNFNVAVLNVGAPAAGMNA
AVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPGKH
IEKIAEQMRKYNINALLVIGGFEALECLLQLYEARNHYEEFCIPLCMLPATISNNVPGTD
LSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADAAYIYE
EPFDIRDLQSNVEHLTEKMKTSIQRGLILRNENSSENYTTDFIYQLYSEEGKGVFDCRKN
VLGHMQQGGAPSPFDRNFGTKISAKAMQWISKKLNECYRKDEGRVFANTEDSACLLGMRR
RNLIFQPVVQLKDDTDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVERSRG
KETDVTASI
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcctgacaccaagaagttttttgagaatctctccggagctgggaaagccata
gcggtgctgacgagcggaggagatgctcaaggtatgaatgcagccgtaagggctgtggtg
cgaatgggaatctatgtaggagccaaagtctacttcattcatgagggatatcagggtatg
gtggatggaggtgataacataaaggaggccaaatgggagagtgtgtccagcatgctgcaa
gtgggtggcactgtgatcggaagtgcacggtgtaaagagtttaggacacgtgaaggacgt
ctgaaggcagcccataaccttgtgcagcatggaatcaccaacctgtgtgtcatcggtgga
gacggcagtctgacaggtgccaacctcttcagggaggagtggagcgacctgcttgctgag
cttgtccagcaaggtctgattgatgatgaggctgtacagaaatattcagccttgcacatc
gtgggaatggtgggatctatcgacaatgacttctgtggcacagacatgacaatcggcaca
gactctgctctccacagaatcatcgaagtggtggatgccatcatgactactgctcagagc
catcagaggacgtttgtgctggaggtgatgggtcgacactgcggctacctggccttggtg
agtgctttggcgtgcggtgcggactgggttttgattcccgagatgcctccggaggacggc
tgggaggagacgatgtgtgagaaactgtctgcgaatcgggcaggaagaaaaaggctgaat
atcataatagtagccgagggcgccattgatcgtagcaacaagcctataaccacagatcgt
gtgaaagatctagtggtccgctgcctgggctttgatacacgtgtgactatcctgggtcac
gtccagagaggaggaacgccatcagccttcgacagaatcctggcgagtcgtatgggcgtg
gaggccgtactggctctgctggagaccacggccaacacaccggcctgcgtcgtctccctg
tgtggaaaccaggctgtgagactgcctctcatggagtgtgtgcagatgacccaggaggta
cagaaggccatggacgagaagaagtttgaagatgctgtaaagcttcgtggcaggagtttc
gagaacaatctaaagacctacaagctcctggctcaccgcaaaccagaatctgaacttcca
tgtagcaacttcaacgtggcagtgttgaatgttggtgctccggcagcgggcatgaatgcg
gccgtgcgctctgccgtcagagtgggcatcaccgaggggcacaaaatgttcgccgtcaac
gacggcttcgagggcttctataagggacagataaaagagattaaatggggagatgtaggg
ggctggacaggccagggaggatctctgctaggaactaaaaggacgcttcccggaaagcac
attgaaaaaatcgctgagcagatgaggaaatataacataaacgcattgctggtcatcgga
ggatttgaggcgcttgagtgtctgctgcagctctatgaggctcgcaaccactatgaggag
ttttgcatcccgctgtgtatgctaccagctaccattagtaataatgtacctggcactgac
cttagtatcggggcagacactgcccttaatgccatcgtggagacatgtgaccgtatcaag
cagtcagccagtgggacaaagcggcgtgtgttcatcattgagacgatgggagggtactgt
ggttatctggccagcgtgggcggtctggcagcgggtgctgacgccgcttacatttatgaa
gagcccttcgacatccgagaccttcagtctaacgtggagcatttaacagagaagatgaag
accagcattcagcgaggactcatcctcaggaatgagaacagtagcgagaactacacaaca
gatttcatttatcaactctactcagaggagggcaaaggcgtgttcgactgcaggaagaat
gtacttggccacatgcagcagggaggcgctccatccccgttcgaccgcaactttgggact
aaaatctcagccaaggccatgcagtggatctcgaagaagttgaatgagtgttacaggaaa
gacgaagggagagtgtttgctaacactgaggactcagcctgtttgttggggatgcgtcgc
cgtaacctcatcttccagcctgtggttcagctgaaggatgacactgactttgttcacaga
attcctaaagagcagtggtggctgaagcttcgtcctctgatgaagatcttggccaagtac
aagacgagctatgacgtgtccgactcgggccagctggaacacgtcgagcgcagccgaggc
aaggagaccgatgtcactgcctccatctga

DBGET integrated database retrieval system