KEGG   Ictalurus punctatus (channel catfish): 100528292
Entry
100528292         CDS       T04658                                 

Gene name
cdkn1b, cdn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04012  ErbB signaling pathway
ipu04068  FoxO signaling pathway
ipu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100528292 (cdkn1b)
   04068 FoxO signaling pathway
    100528292 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100528292 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100528292
NCBI-ProteinID: NP_001187491
UniProt: E3TEH3
LinkDB
Position
14
AA seq 170 aa
MSNVRLSNGSPTMERMDAARLGDQPKPSACRTLFGPVDHEELKRELMGHLKAMEEAAAET
WGFDFSTHTPRPNARFIWKVVDSKDLPSFYSASEPPSKSVCVSGNNGVDLNGNCGLTEQK
EDRSEKQTDRTDKRKRPACVDSSSCSTKRLRTCLNETPHTPKKCSPPRHT
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtcgaacgtgcgcctgtcgaacgggagcccgaccatggagaggatggacgcggcgagg
ctgggggatcagcccaaaccgtcggcgtgcaggactctgttcggtccggtggatcacgaa
gagttaaagagggagttaatgggccacctgaaggcgatggaagaggcggcggccgagacc
tggggcttcgacttctccacacacacaccgcggcccaacgccagattcatctggaaagtg
gtggacagtaaggacttaccgagtttctacagcgcgtctgaaccgccgagtaaaagtgtg
tgtgtgtccgggaataacggagtggatctaaacgggaactgtggactaaccgagcagaag
gaggacaggtccgagaaacaaaccgacaggacggacaagaggaaaagacctgcgtgtgtc
gactcgtcgtcttgttcgactaaacgcttgcgcacctgtttaaatgaaactcctcacaca
ccgaagaaatgcagtccgccgagacacacgtaa

DBGET integrated database retrieval system