KEGG   Ictalurus punctatus (channel catfish): 100528309Help
Entry
100528309         CDS       T04658                                 

Gene name
tk1, kith
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00240  Pyrimidine metabolism
ipu00983  Drug metabolism - other enzymes
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100528309 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100528309 (tk1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100528309 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 100528309
NCBI-ProteinID: NP_001187508
UniProt: E3TEJ9
LinkDB All DBs
Position
10
AA seq 231 aa AA seqDB search
MDCLDVPRILPNSPSKIRGQIQVIFGPMFSGKSTELMRRVRRFQVAQYNCLVIKYARDTR
YSDTGMATHDKNTMEAVPANCLRDVYSRALQACVIGIDEGQFFPDTVEFCEAMANMGKTI
IVAALDGTFQRKPFGNILNLVPLAESVVKLNAVCMQCFKEASYTKRLGAEQEVEVIGGAD
KYQAVCRVCYGGQMANKENWAPQRDETPPHVLKGKQVDHSASRKLFASLHL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggactgtttagacgtaccgaggattttgccaaactctccaagcaaaatacggggtcag
attcaggttatttttggaccaatgttctcagggaaaagtactgagctgatgaggagagtc
cgtcgctttcaggttgcccagtacaactgcttagtgatcaaatatgccagagacactcgt
tactctgacacgggcatggccacacacgacaaaaatacaatggaagccgtgccagcgaac
tgtctgagagatgtctattctcgtgccctacaggcctgcgtcatcggcattgatgaaggc
cagtttttcccagacactgttgaattctgtgaggccatggcaaacatggggaagacgatt
attgtcgcagcacttgatggcacatttcagaggaagccctttggcaacatactgaatctg
gtccctttggctgaaagtgtggtgaagctgaacgcagtctgtatgcagtgctttaaagag
gcgtcctacactaagagacttggagcagagcaagaggtggaggtgattggaggagctgat
aaataccaagcagtgtgcagggtgtgttatggaggccagatggcgaataaagagaactgg
gcaccccagagggatgagacgccccctcacgttctaaaagggaagcaggtggaccacagt
gcatcacgcaagcttttcgcttcccttcatctatga

DBGET integrated database retrieval system