KEGG   Ictalurus punctatus (channel catfish): 100528393Help
Entry
100528393         CDS       T04658                                 

Gene name
adprh
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100528393 (adprh)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     100528393 (adprh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 100528393
NCBI-ProteinID: NP_001187592
UniProt: E3TEX4
LinkDB All DBs
Position
13
AA seq 352 aa AA seqDB search
MESPATVDHYKAGMVLSGVGDALGFRWEFIYSAPHIQQEVQNLGGVKKISVSLPNWPVSD
DTVLHLATAEALTTGKEGEELLHEVTVRYIKGMKDMSRRAPGMTTIRGVDQLKPGAQGGY
RIAYDRSSGGCGAAMRAMCIGLRYPRPEQLSSLVAVAVETGRMTHTHPTGFLGGVASALF
AAYAIQRRPIITWGLGLVKEACPIAKEFVRSAGYAVPETERDWGYFTEKWEKYLELRGLS
SGTGPVVFPKQYGPSERDEAYKSFSWSGWGGSSGHDAPMIALDALLGSGSNWEELMSRAG
FHGGDSDSTAVIACCCWGLMYGMEGVPKCNYTNLEYRDRLENSAEKLYTLSH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagagtcctgcgactgttgatcactacaaggccggcatggtgctgagcggcgtgggt
gatgctctcggcttccggtgggagtttatatattctgcaccacatatccaacaggaagtt
cagaatcttggaggagtgaagaaaatctctgttagccttcctaattggccagtcagtgat
gacacagtgcttcacttggcaaccgctgaagctttaaccacaggtaaggaaggtgaggaa
ctgctgcatgaggtgactgtccgttacataaagggtatgaaggacatgtctaggagggct
ccaggaatgacgaccatccgtggtgtggatcaattaaagccaggagctcaaggaggctac
agaattgcttatgaccgatcaagtggaggatgtggtgctgccatgagggctatgtgcatt
ggtctgagataccctcgaccagagcagctctcctcattggtcgcagttgctgtggagact
gggagaatgacacacactcatccaactggattccttgggggtgtggcttctgcactgttt
gcagcctatgccatccagcgccgtccaattataacctgggggctgggcttagtgaaggag
gcttgtccaatagcgaaggagtttgtgaggtcagcaggatacgccgttcccgagacggag
agagactgggggtactttactgagaagtgggaaaagtatcttgagttgaggggtttgtca
tcaggaactggtccagtagtctttcctaagcaatacggaccttctgaacgcgacgaggca
tacaaaagcttcagttggtctggatggggaggtagcagtggtcacgatgcaccgatgata
gctctggatgccctcctgggctcggggtcaaactgggaggagctaatgagccgagctgga
ttccacggaggagacagcgacagcacggcggtcatagcgtgttgttgttggggtttgatg
tacgggatggagggagtgcccaagtgtaactacaccaacctggagtacagggaccggctg
gagaacagtgctgagaaactttacacactgtcacactga

DBGET integrated database retrieval system