KEGG   Ictalurus punctatus (channel catfish): 100528431
Entry
100528431         CDS       T04658                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100528431 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100528431 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ipu04052]
    100528431 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ipu00536]
    100528431 (fgf1)
Cytokines and growth factors [BR:ipu04052]
 Growth factors
  Growth factors (RTK binding)
   100528431 (fgf1)
Glycosaminoglycan binding proteins [BR:ipu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100528431 (fgf1)
SSDB
Motif
Pfam: FGF IL1
Other DBs
NCBI-GeneID: 100528431
NCBI-ProteinID: NP_001187630
UniProt: E3TF24
LinkDB
Position
14
AA seq 155 aa
MSEAEVVAHFPRGSDKLDLSGLKPTELTRLYCMKGGHHLQLLPEGSVRGSRDEHDPYSVL
RIKSVSAGVVVIEGTEAKRFLSMSEDGKLYGSLSVTDESYFLEKMEENHYNTYKSQKYGP
DWYLGIKKNGKPKRGSRTHIGQKAIFFLPRQVEQG
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtcggaggcggaagttgtggcacatttcccccgcggttctgataaactggacctcagc
gggttgaagcccacagagctgacccggctgtactgcatgaaaggcggtcaccacctgcag
cttctccccgagggctcagtgagaggaagcagagacgagcacgacccttacagtgtgttg
cggattaaatccgtgagcgccggagtggtggtcatcgagggaacagaggccaaacgcttc
ctctctatgagtgaggatggcaagctgtatggatcattgtcggtaacagatgaaagttac
ttcctggagaagatggaggagaatcactacaacacgtacaaatcccagaagtacggccca
gactggtatcttggaatcaaaaagaatgggaaaccaaagcgaggctcgaggacacacatt
ggacagaaggccattttctttctacctcggcaggtggagcaaggataa

DBGET integrated database retrieval system