KEGG   Ictalurus punctatus (channel catfish): 100528601Help
Entry
100528601         CDS       T04658                                 

Gene name
sdhb, dhsb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00020  Citrate cycle (TCA cycle)
ipu00190  Oxidative phosphorylation
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
Module
ipu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ipu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ipu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100528601 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100528601 (sdhb)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100528601 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100528601
NCBI-ProteinID: NP_001187800
UniProt: E3TFQ1
LinkDB All DBs
Position
21
AA seq 280 aa AA seqDB search
MSAVSFSLRRSGVAAMRSSALPASARYMQTAAAAQPRIKTFQIYRWDPDKPGDKPHMQTY
DIDLNTCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACLNRIDTNT
SKVSKIYPLPHMYVVKDLVPDMNNFYAQYKLIEPYLKRKDESQQGKEQYLQSVDDRQKLD
GLYECVLCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMVDSRDEYTEERLAKLQDPFSLY
RCHTILNCTKSCPKGLNPGKAIAEIKKMMATYKEKKAVTV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgtgagtttctccttgaggcgctccggtgtagcggcgatgcgctcctcagct
ctcccagcgagtgcccggtacatgcagacagcagcagccgctcagccacgcattaagacg
ttccagatttaccgctgggatccggacaaacccggagacaaaccgcacatgcagacgtac
gacatcgacctcaacacctgtgggccgatggtattggacgctttgattaagataaagaac
gaggtcgactcgactctcaccttcagacgctcctgcagagaaggtatctgcggttcgtgt
gcgatgaacattaacggtgggaacacgctggcgtgcctgaacaggatcgacactaacacc
agtaaagtgtctaagatttaccctctgccccacatgtacgtggttaaagacctggtaccg
gacatgaataatttttacgctcagtacaagttgatcgagccgtatctgaagaggaaggat
gagagtcagcaggggaaggagcagtacctgcagagcgtggacgaccgacagaaactggat
ggtctgtacgaatgtgtcctgtgtgcgtgctgcagtaccagctgtcccagttattggtgg
aacggagataaatacctgggacccgccgtcctcatgcaggcgtaccggtggatggtggac
tctcgtgacgagtacacagaggagcgtctggctaaactgcaggacccgttttctctgtac
cgctgtcacaccatcctaaactgcaccaagtcctgccccaagggtctgaatcccgggaag
gccatcgctgagattaagaaaatgatggcgacgtataaggagaagaaagcagtaactgtg
tga

DBGET integrated database retrieval system