KEGG   Ictalurus punctatus (channel catfish): 100528674Help
Entry
100528674         CDS       T04658                                 

Gene name
sord, dhso
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00040  Pentose and glucuronate interconversions
ipu00051  Fructose and mannose metabolism
ipu01100  Metabolic pathways
Module
ipu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100528674 (sord)
   00051 Fructose and mannose metabolism
    100528674 (sord)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100528674 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 100528674
NCBI-ProteinID: NP_001187873
UniProt: E3TG01
LinkDB All DBs
Position
27
AA seq 354 aa AA seqDB search
MEKDNLSLVLHSKGDIRLEQRPIPEPGADEVLLQMHSVGICGSDVHYWQNGRIGDFVLQK
PMVLGHEAAGRVVKVGSAVTHLKPGDRVAIEPGVPREMDEFFENGRYNLSPTVFFCATPP
DDGNLCRYYKHSANFCYKLPDNVSYEEGALIEPLSVGIHACRRAGVTLGSSVFICGAGPI
GLVTLLVAKFMGASQVLISDLSADRLAKAKELGADFVLPVKREDVPKDMAKRVDGMLGGM
PHITIECTGVESSIQTAIYTTRSGGVVVLVGLGAEMTTVPLLTAAVREVDIRGVFRYCNT
WPMAISMLASKRVNVMPLVTHRFPLEQAVQAFETTRQGIGIKVMLKCDKNDQTP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagacaacctttccctggttttgcactctaaaggcgatataaggctggaacaa
cgtcccattccagagcctggagctgatgaggttttactccagatgcactcggtgggtatc
tgtggctctgatgtgcactactggcagaatggacggatcggggactttgtccttcagaag
ccaatggtcctgggtcatgaggcagcagggcgagtggtcaaagtgggctctgcagtcact
catctcaaaccaggtgacagggtggctattgaacctggagttcccagagaaatggacgag
tttttcgaaaatggccgctacaacctatcacccactgtgttcttctgtgccacaccacct
gatgatgggaacctctgcagatactacaaacatagcgccaacttctgctacaagcttcct
gataatgtgagttatgaggaaggggctctgattgagccgctctcagtggggattcacgca
tgcaggagagccggagttactctgggcagctctgtgttcatctgtggagcaggaccgatc
ggtctggtcactctgttggtagctaaattcatgggagcctctcaagtgcttataagcgac
ctttctgctgataggctggccaaggccaaggagttaggtgctgactttgttcttcctgtt
aagagagaggatgtaccaaaggatatggccaaacgtgtagatggcatgctggggggcatg
cctcacatcaccatagagtgtaccggtgtagagagcagcatccaaacagcaatctatacc
acacgttctggaggtgtagtcgttttggttggactcggtgctgaaatgaccacagtgcct
ctccttaccgctgctgtcagagaagtggacatccgaggcgtgtttcgctactgcaacacg
tggcctatggctatttctatgctggcctctaagcgtgtgaatgtgatgccactggtcaca
caccgctttccactggagcaagctgtacaggcatttgagacgactagacagggcattggg
atcaaagtcatgctgaaatgtgacaaaaatgaccagaccccatga

DBGET integrated database retrieval system