KEGG   Ictalurus punctatus (channel catfish): 108255249
Entry
108255249         CDS       T04658                                 

Gene name
Rassf1
Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
ipu  Ictalurus punctatus (channel catfish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 108255249
NCBI-ProteinID: XP_017306562
UniProt: W5UFR8
LinkDB
Position
21
AA seq 382 aa
MSHWELIELQDLSLRDRIELATAAGPVGPQKPPEQPSTHDTVRLVGDTVRLVGDTVRLVG
DTVRLVGDTVRFDVSFWETFRQGKGHDFQACGHTHLAWCDLCGEFIWGVYKQSLRCVHCR
YTCHSRCRPLIQLNCEAVLGPSDSSEDIETDTDVDTVVDWRKEQQLSVTELQHKVKEYNA
QINSNLYMSLNRDGSYTGFIKVQFQLARPISLPPTLIPPSSSSSSSSSCSSFSSLPSSHG
LCTSFYLPRDMAKQLHVSSRTRVREVIQALLNKFTVVDNPAKFALFERSERNGQVYVRKL
CDDERPLFLRLCAGPSENTLSFILRENETGEVNWDAFSLPELGNFLRILQREEEEHVRQI
VQRYSLARDKLKEALRSFSTPG
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtcccactgggagctgattgagctgcaggacctctccctcagagacaggatcgagtta
gcgaccgctgccggacccgtgggcccccagaaacccccggagcagccgagcacacatgac
acggtgcgtctggtcggagacacggtgcgtctggttggagacacggtgcgtctggtcgga
gacacggtgcgtctggtcggagacacggtgcgtttcgacgtttcgttctgggagacattc
agacaggggaaaggtcacgatttccaggcctgcggtcacacacacctcgcctggtgcgac
ctgtgtggagagttcatctggggtgtttacaaacagagcctgcgctgtgtccactgcagg
tacacatgtcactcccgctgtcggcccctgatacagctgaactgtgaagccgtgctcgga
ccctcggacagcagcgaggacatcgagacagacacggacgtggacactgtggtggactgg
aggaaagagcagcagctctccgtcactgaactccaacacaaagtcaaagaatacaacgct
cagatcaacagcaacctctacatgagtctgaaccgggacggctcatacactggtttcatc
aaggtccagttccagctggctcggcccatctctcttcctcccactctcattcctccctct
tcctcatcctcctcttcctcttcttgctcctccttttcctccctgccctcctcgcatggc
ctctgcacgtcgttctacctgccccgagacatggccaagcagctgcacgtcagctctcgc
acccgggtccgagaggtaatccaggctctgctcaacaagttcacagtggtggacaatccg
gccaaattcgctctgttcgaacgcagcgagaggaacggccaggtgtacgtcaggaagttg
tgtgatgatgagcgtccgctcttcctgcgtctctgtgcaggccccagcgagaacacgctt
agcttcatactcagagagaacgagacaggagaggtgaactgggacgcgttcagtctcccc
gagctcggcaacttcctgcggatcctgcagagggaggaggaggagcacgtccggcagatc
gtacagcgctactcactggcacgggacaaactgaaggaggcgctgaggagcttcagcacg
ccgggatga

DBGET integrated database retrieval system