KEGG   Ictalurus punctatus (channel catfish): 108255284Help
Entry
108255284         CDS       T04658                                 

Gene name
park7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     108255284 (park7)
Peptidases [BR:ipu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   108255284 (park7)
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108255284 (park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 108255284
NCBI-ProteinID: XP_017306634
UniProt: A0A2D0PKV9
LinkDB All DBs
Position
21
AA seq 189 aa AA seqDB search
MAAKRALVILAKGAEEMETVIPVDVMRRAGIAVTVAGLTGKDPVQCSRDVLICPDSSLEE
ASKQGPYDVVLLPGGLLGAQNLSESPAVKEVLKEQEGRKGLIAAICAGPTALLAHGIGFG
STVTTHPGAKDKMMAGDHYKYSEARVQKDGHLITSRGPGTSFEFALTIVEELLGAEVASQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaagagagccttagtgattttggcgaagggggcggaggagatggagacagtg
atacccgtggacgtcatgcgcagagctgggatcgctgtgactgtagcaggactgacgggg
aaggatcctgttcagtgtagccgtgatgtcctcatctgtccagattcgagcctggaggaa
gcctcgaaacagggcccatatgatgtggttctgttacctggaggactgctcggagcccag
aacctgtccgagtctcctgctgtgaaggaggtgttaaaggagcaggagggcaggaaaggg
ctgattgccgccatctgcgcaggtcccacagcacttttggctcacggaatcggtttcggc
agcacagtcacgacccacccgggtgctaaagacaagatgatggctggagatcactacaag
tattcagaggcccgtgttcagaaagatggacacctgatcacgagccgaggcccgggcacc
agcttcgagttcgccctgaccatagtggaggagctgctgggtgccgaggtggcctctcag
gtcaaagctccacttgtcctgaaagattaa

DBGET integrated database retrieval system