KEGG   Ictalurus punctatus (channel catfish): 108255500Help
Entry
108255500         CDS       T04658                                 

Gene name
hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04110  Cell cycle
ipu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    108255500 (hdac2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    108255500 (hdac2)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108255500 (hdac2)
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     108255500 (hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     108255500 (hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108255500 (hdac2)
  Chromatin remodeling factors
   NuRD complex
    108255500 (hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 108255500
NCBI-ProteinID: XP_017306960
UniProt: W5UDD7
LinkDB All DBs
Position
2
AA seq 489 aa AA seqDB search
MAFTLHGAVKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHK
ATADEMTKYHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSA
AGAVKLNRQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIH
HGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDDSYE
QIFKPVMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIRGHAKCVEYMKSFNLPLLML
GGGGYTIRNVARCWTYETAVALDTDIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTQEY
MDKIKQRLFENLRMLPHAPGVQMQPIPEDSIPDDTADEDMEDPDKRMSIRASDKRIACDE
EFSDSEDEGEGGRRNVANHKKGVKRARMEEDRKEGEEKKGEVKEEEKPKEINSDKHDSKS
VKTEQTSST
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcactttgcacggcgcggtgaagaagaaagtctgctattattacgacggtgat
attggtaattattattatggacagggccaccccatgaagcctcaccggatccgcatgacg
cacaacctgctgctgaactacggactgtaccgcaagatggagatctacaggcctcacaaa
gcaacggcagatgaaatgacaaagtatcacagtgacgattatatcaagttcctacgctcc
atccgaccagacaacatgtccgagttcagcaaacagatgcagcgctttaacgtgggtgag
gactgtccggtgtttgatggactgtttgagttctgtcagctctcaacaggaggttcagca
gccggtgcggtgaagctgaaccgacagcaaacagacattgcggtgaactgggccggaggt
ctacaccacgctaagaagtcagaagcgtctgggttctgctacgttaatgacatcgtactc
gccatactggagctgctcaagtaccaccagagggtgctgtacatcgacatcgatattcac
catggcgacggggtggaggaggcattttacaccacggaccgcgtcatgactgtctccttc
cacaagtacggagagtacttccccggaaccggagacctgcgggatatcggtgcaggtaaa
ggtaaatactacgcagttaattttcctctgagagacggaatagacgacgactcgtacgaa
cagatcttcaaacctgtgatggcgaaggtaatggagatgtatcagccgagtgctgtggtg
ctgcagtgcggagctgattctctctcaggcgaccgactcggctgcttcaacctcaccatc
cgtggtcatgctaagtgtgtggagtatatgaagtcctttaatctgccgttgttgatgttg
ggtgggggaggttacaccattcgcaacgtcgctcgctgctggacctacgaaaccgccgtt
gccctggataccgacatccctgatgagttgccgtataatgattattttgaatattttggt
ccggactttaagctgcacatcagtccgtctaacatgaccaaccagaacacacaggagtac
atggacaagatcaagcagcgtctgtttgagaacctgcgcatgttaccccacgcgcctggg
gttcagatgcagcccattccagaggacagtattcctgatgacaccgcggacgaggacatg
gaggacccggacaaacgcatgtccatccgagcatcagataagaggatcgcgtgtgatgaa
gagttctcggactcggaagatgagggagagggggggcgcaggaacgtggccaatcacaag
aagggagtgaagcgggcgcggatggaggaagacaggaaagagggggaggagaagaaagga
gaagtgaaggaggaggagaaaccgaaggagatcaactcagataaacatgattcaaagagt
gtaaagactgagcagaccagcagtacctga

DBGET integrated database retrieval system